KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06170Help
Entry
NSED_06170        CDS       T02303                                 

Definition
(GenBank) response regulator receiver protein
  KO
K03413  
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:nir00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NSED_06170
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    NSED_06170
Two-component system [BR:nir02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   NSED_06170
Bacterial motility proteins [BR:nir02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    NSED_06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1022851..1023213)
Genome map
AA seq 120 aa AA seqDB search
MAKILIADDSDAIRLVLKDIISIGNHDVVAEAIDGEESIDLYKEVKPDLILLDLAMPKKD
GLSVVKEIISFDSNAKIILITASDDQKIIQECMSHGALSYISKPFDFKVVLKGIDDVLAK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatcctgattgctgatgactctgatgcaatccgactcgttttaaaagatatt
atttctattggaaatcatgatgtagttgctgaagccatcgatggtgaagaatctattgat
ttgtataaggaggtaaagcctgatttgattttattggatttggcaatgcccaaaaaggat
gggttgtcagttgttaaggaaataatttcatttgattctaatgccaagataattctcatc
actgctagtgatgatcaaaaaattatccaagaatgcatgtctcatggtgcattgtcctat
atctcaaaaccgtttgatttcaaagttgtcttaaaagggattgacgacgttttagcaaag
taa

DBGET integrated database retrieval system