KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06260Help
Entry
NSED_06260        CDS       T02303                                 

Definition
(GenBank) isopropylmalate/citramalate/homocitrate synthase
  KO
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NSED_06260
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NSED_06260
Enzymes [BR:nir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     NSED_06260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1037294..1038808)
Genome map
AA seq 504 aa AA seqDB search
MKIRIFDTTLRDGEQTIGVSLSPDQKLSIAKKLDELGVDAIEAGFPVISEGELKAVKMIT
SEGLSCEIAGLTRTIKKDIDAAVDAGLNYIHTFIATSDIHLEHKLKMTRDQALEKAIEAV
EYGKSRGLQVEFSAEDASRTDREFLKKVFGEVAKAGADRVNIPDTVGYSTPEYMAKITKD
TVEATKLPVSVHCHNDFGLAVANSLAGIHAGAACAHVTINGIGERAGNASLEELSMALKC
LPYDQKYETNIKSELIYDASRFISKTVGIIVQPNKAIVGANAFGHESGIHTHGVLSNPLT
YEPISPELVGRKRWLQVGKHAGVHGMNAMLSEYGVKPTEEQSQQILDKVKVLGDQGKQIT
DVELLSIASDVLGEKDLKKIVQLTGFSVSTGIGTMPYAFVKLNIDGQDHVGTDYGVGPVD
AALNAIQKITGKLSEIRIKDYGLASISGGSSALCEVTVKVEDALGNKVSAKSVGEDIVTT
SVKAVIDAINHIMLKKLLHEKQVR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagaatatttgatacaacattaagagatggggaacaaacaattggtgtttct
ttatctccagatcaaaaattatccattgccaaaaaactcgatgaacttggtgttgatgca
attgaagctggttttccagtaatctctgaaggtgagttaaaagcagtaaaaatgattact
agtgaaggattgtcatgtgaaattgcaggattaacaagaactattaaaaaagacattgat
gctgcagttgacgctggattaaactacatccacacattcattgcaacttctgatattcat
ttagaacataaactcaaaatgactcgagatcaagctcttgagaaagcaattgaagcagta
gagtatggaaaatctcgtggattgcaagttgaattttcagctgaagatgcttctagaact
gatagagaatttttaaaaaaagtatttggcgaggttgcaaaagccggagcagaccgtgta
aacattcctgatactgtggggtactctactcctgaatacatggcaaaaatcactaaagat
acagtagaagctacaaaacttccagtaagtgttcattgtcataatgattttggattggca
gttgcaaattctttggcaggaattcatgcaggagctgcatgtgcacatgttacaataaat
ggaattggtgaacgagctggtaatgcttcattagaagaactttctatggcattgaagtgt
ttaccatatgatcaaaaatatgagacgaacatcaaatctgaattaatttacgatgcctca
agatttatctctaaaactgtgggtattattgttcagcctaacaaggccatagttggagca
aacgcatttggccatgaatcaggaattcatacacatggtgtattgagtaatccgctaaca
tacgagccgattagcccggaattagtaggacgaaaaagatggcttcaagttggaaaacat
gcaggggttcatggtatgaatgcaatgctttctgaatatggagtaaaacctactgaagaa
caatcccagcaaatcttagacaaagtcaaagtgttaggtgaccaaggaaaacagatcact
gatgtggagttgctctctattgcaagtgacgtcttgggagaaaaagacctcaaaaaaatt
gttcaactaactggattctcagtatccactggaattggaactatgccttatgcatttgta
aaactaaacattgatggtcaggaccatgtcggaactgattatggggtaggacctgtggat
gcagcactaaatgcaattcaaaaaattactggaaagctttctgaaatcagaattaaggat
tatggattagcatcaatttctggcggttctagtgcattatgtgaggttacagtaaaggtt
gaagatgcattaggaaacaaagtctctgcaaaatctgttggtgaagacattgtaactaca
tcagttaaagcagtaattgatgccattaatcatatcatgctcaaaaaattgttacatgaa
aaacaggtacgataa

DBGET integrated database retrieval system