KEGG   Candidatus Nitrosopumilus sediminis: NSED_06310Help
Entry
NSED_06310        CDS       T02303                                 

Definition
(GenBank) metallophosphoesterase
  KO
K06953  uncharacterized protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: AFS83064
UniProt: K0BC60
Position
1045000..1045749
Genome map
AA seq 249 aa AA seqDB search
MLQTRIVPSKPALILEGKKKNLVITDIHIGFENSMASNQIFIGKNSTINESIQELSQIID
LEKPDSVILLGDIKSSIKNISRNEWDEVPLFFKKIREKCDVTLIPGNHDANIQRLVPDNI
SMISSTGMVEENVLLTHGHTMPSENFSHVDKIIMGHVHPVFFQEDSIMNGQRVWVSIKTE
KENIFPNKPGEIEITIVPSFNKYFYATHRKQYKKSISPIINKIKEISKAKIITLDGTIIG
TESDIKQVI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaactagaatcgttccatcaaaacctgcactgattttagaaggtaaaaaaaag
aatctggttattacagatatccacattgggtttgaaaatagcatggcatcaaaccaaata
ttcataggcaaaaattcaacaattaatgaatcaattcaagaattatctcaaattattgat
ttagaaaaaccagactcagttattttgttgggagatatcaaatcaagcatcaagaacata
tcaagaaatgaatgggatgaagtcccattattttttaaaaaaataagagaaaagtgcgat
gtaactctaattccaggcaaccatgatgcgaatattcagaggttagtgccagacaatatt
tcgatgattagttcaacagggatggttgaagaaaatgttttgttaacacatggacataca
atgccatcagagaacttttctcacgtagataagatcattatgggtcatgttcatccagtt
tttttccaagaagattcaatcatgaacgggcaaagagtgtgggtttcaatcaagacagaa
aaagaaaatatcttccccaataaaccaggggagatcgaaataacaatagttccatcattt
aacaaatatttttacgcaacacataggaaacaatacaaaaaatctatttctccaattatt
aataaaataaaagagatatcaaaagcaaaaatcataacgttggatgggacaataattgga
accgagtcagacatcaagcaagtgatttga

DBGET integrated database retrieval system