KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06370Help
Entry
NSED_06370        CDS       T02303                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase family protein
  KO
K07006  
uncharacterized protein
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1056894..1057262
Genome map
AA seq 122 aa AA seqDB search
MINLDEIKSEKYISLETYRKNNQPVRTPVWFVVKDDLIYVVTRSKTGKVKRLKNNLQVKF
ALCTIKGKVTGEWISGTATILNEEETKKAVKRRDKKYGFMAKISKFLSKSKGGFFAFTIK
AD
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgataaatttagacgaaattaaatccgaaaaatatatctcgcttgaaacttatcgaaaa
aataatcaaccagttagaacaccagtatggtttgtagtcaaagatgatttgatttatgtc
gtcacacgcagtaaaacaggcaaggtaaaacgtctaaaaaacaatttacaagtaaaattt
gcattgtgtacaattaaaggtaaagttacaggagaatggatttcaggaactgccacaatt
ctaaatgaagaagagactaaaaaagcagtaaagagaagggataaaaaatatgggtttatg
gcaaaaatttcaaaattcctgagtaaaagcaagggaggattttttgcatttacaattaag
gcagattaa

DBGET integrated database retrieval system