KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06385Help
Entry
NSED_06385        CDS       T02303                                 

Definition
(GenBank) 2-methylcitrate synthase/citrate synthase II
  KO
K01647  
citrate synthase [EC:2.3.3.1]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NSED_06385
   00630 Glyoxylate and dicarboxylate metabolism
    NSED_06385
Enzymes [BR:nir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     NSED_06385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1058819..1059982
Genome map
AA seq 387 aa AA seqDB search
METKNIGLRGIEVADTRISNIDGEKGKLIYRGYDILELTKNSTFEETAYLLLYDKLPNRN
QLDEFNAKLIDARFIPKQMQKNMGNWRKDADPMDMLQAFVAALAGYYDEEFANKEASYDK
AINLIAKVPTIVASWNRIRNGLDIVDPDPTLSHAANFLYMMSGKRPDPEVEKIFDVCLIL
HADHTFNASTFTARQVASTRAHMYSACSAAIGALSGELHGGANTEVMKMLLEIGDIEKVE
EWVKKEMSEGNRIMGMGHAVYKTYDPRAQVLKELSRKLAEKTKDPWFDITEKIEVTTISE
MKKQKGKDIYPNVDLYSASLYYMLKIPMDLNTPIFAISRVVGWAAHIIEEKFAEAAPKPA
LYRPKATYVGKYCGPEGCEYQTLDLRK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaaaaatatcggccttcgtggaatcgaagtagcagatacgagaatttccaat
attgacggagagaaaggaaagctaatctaccgaggatatgatattttagaattaaccaaa
aattcaacatttgaagaaacagcatatttacttctttatgacaagcttccaaatagaaat
caattagatgaatttaatgccaaattaattgatgccaggttcattccaaaacaaatgcaa
aaaaacatgggcaattggagaaaagatgcagatcctatggatatgcttcaggcttttgtg
gcagcacttgctggatattatgatgaagaatttgcaaacaaagaagcaagttatgataag
gcaataaacctgattgcaaaagttcccacaattgttgcaagttggaacagaataagaaat
ggactagacatagtagatccagacccaacactaagtcatgcagcaaattttctatacatg
atgtcaggtaaaagaccagatccagaagttgagaagatcttcgacgtgtgtttaattttg
catgcagatcatacgtttaatgcatctacatttactgcaagacaagtggcatctactagg
gcacacatgtattcagcatgtagcgctgcaattggggcactaagtggggaactacatggt
ggggccaataccgaagtaatgaaaatgctgcttgagataggagatatcgaaaaagtagaa
gaatgggttaagaaagaaatgagcgaaggcaacagaataatgggaatgggtcacgcagtc
tacaaaacatatgatccaagagcccaagtactaaaagaattatctagaaaactagcagaa
aaaacaaaagacccatggtttgacattacagaaaaaatagaagtcaccacaatttctgaa
atgaaaaaacagaaaggaaaagatatctatcctaacgtagacctgtacagcgcatcattg
tattacatgttgaaaattccaatggatcttaatactccaatttttgcaatttcacgtgtt
gtgggatgggctgcacacatcatcgaagaaaaatttgcagaagctgcaccaaaaccagca
ttgtatagaccaaaggccacttatgttggaaaatattgtggacctgaaggttgtgaatac
caaacattagacttgagaaaataa

DBGET integrated database retrieval system