KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06395Help
Entry
NSED_06395        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1060391..1060615
Genome map
AA seq 74 aa AA seqDB search
MQSKYVALHIGLFWGIGVFIIKNKDTIKIKINEKTMFDQLSKGITSNEQFIQKRIKFINQ
LITQRKLKIEYELI
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatcaaaatatgttgcattgcatattggtttgttttgggggataggagtgttcata
attaaaaataaagatactattaaaataaaaattaatgaaaaaacaatgtttgatcagtta
tcaaaaggaataacgagtaatgaacaatttattcaaaaaagaataaaatttatcaatcaa
ctaatcactcaaaggaaattaaaaatcgagtatgaattgatttaa

DBGET integrated database retrieval system