KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06400Help
Entry
NSED_06400        CDS       T02303                                 

Definition
(GenBank) blue (type1) copper domain-containing protein
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1060956..1062236
Genome map
AA seq 426 aa AA seqDB search
MAGIDRAAIAFSIAIVVIGVGFAFYMDGVQNAGPVISAPVASKTVEEKTQTDPFADIANK
VKQEAPAKPMKSGWDRLTSETDPGVGHETHQLAIILAPSDKVYSGTLKYDASEPIQLVTL
HGPLAAGEDKGQAIWTPDGETKFALTFVDPKNARGEWEFAGNALAVHTMNTEPFIVDYKV
DYKEKPMSDTVMTGTVQTVQDPGVGHESHQLAVLLAPSSDVYSGILSYSASENIQLVTLR
GPIGADEKPAKTWTPDGETIFELTFVDPKNAMGSWKFSGNALAVHTMKTNQATISYSVSA
TTTAGKTVQLEEKVAMKETTVDKPTGPTTHTVDIPVGTSVPGCEESNACYLPADITINVG
DTVEWINIDTAAHTVTGGSPADGPSGVFDSSLVMADASYAFTFNDSGSYDYFCMVHPWMT
GSVTVN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtatagacagagctgcaattgcattttctattgcaattgtagtaatcggtgta
ggatttgcattctatatggatggagttcaaaatgccggtcccgttatttctgctccagta
gcttcaaagactgttgaggaaaaaactcaaacagacccatttgcagatattgcaaataag
gtaaaacaagaagctcctgcaaaaccaatgaaatcaggttgggatagactaacatcagaa
acagatcctggtgtaggtcatgaaacacaccaacttgcaatcattttggcaccaagtgac
aaagtatattcaggtacactcaagtatgatgcatctgaaccaattcaacttgttacacta
cacggtccattagcagctggagaagacaaaggacaagcaatttggacaccagatggtgaa
acaaagtttgcattaacatttgttgatccaaagaatgcaagaggcgaatgggaatttgcc
ggtaatgctttagcagtacatacaatgaataccgaaccattcatagttgattacaaagta
gattacaaagaaaaaccaatgtcagatactgtaatgactggcacagtccagacagtacag
gatcctggtgtaggtcatgaatcacatcaacttgcagtgcttttggcaccatcaagtgat
gtatattcaggaattctttcatactctgcttctgaaaatattcaactagttacactacga
ggaccaatcggtgctgatgaaaaaccagcaaagacatggacaccagatggtgaaactatc
tttgaattaacatttgttgatccaaagaatgcaatgggttcttggaaattctcaggtaat
gctttagcagttcacactatgaagacaaaccaagcaaccattagttattctgtaagtgca
actacaactgcaggaaaaactgttcaactagaagaaaaagtcgccatgaaagaaaccacg
gtagacaaaccaacaggaccaacaactcacacagttgatattccagtaggtacttcagtt
ccaggatgtgaagaaagtaatgcatgctacttaccagcagacatcacaatcaatgttgga
gacacagtagaatggattaatatcgacacagcagcacacacagtaactggtggtagtcca
gctgatggaccatccggcgtatttgatagcagtctagtcatggcagatgcatcttatgca
tttacattcaatgactcaggcagttatgattacttctgcatggttcacccatggatgacc
ggtagtgtcacagtgaactaa

DBGET integrated database retrieval system