KEGG   Candidatus Nitrosopumilus sediminis: NSED_06405Help
Entry
NSED_06405        CDS       T02303                                 

Gene name
uvrC
Definition
(GenBank) excinuclease ABC subunit C
  KO
K03703  excinuclease ABC subunit C
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:nir00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    NSED_06405 (uvrC)
DNA repair and recombination proteins [BR:nir03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     NSED_06405 (uvrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrC_HhH_N GIY-YIG UVR LIN52
Motif
Other DBs
NCBI-ProteinID: AFS83081
UniProt: K0BFJ6
Position
complement(1062257..1063843)
Genome map
AA seq 528 aa AA seqDB search
MTFDISKINIPTDPGIYLMKDTDGTIIYIGKAKNLKNRVKSYFNKNQNYKTQKLVENISD
VEFVLTDNESEAFLLESNMIKKYRPRFNIELKDQQRYTYLRISDEKYPRLLVSRRTRDGK
FLGKGKTFGPFTQGSSKLLTIGTLRKAFQIRICKTLPKKVCLEYHLGNCEGPCEFKDAQE
RYPKHVQALQDVLKGKNQTKIFTKKLKEEMQQAAKLQQFERAKDIRDTLIRLGSLQTKQK
MEYVENSDEEYFGIGIQEHSATVMNFRMINGVIRDSDKFFYDLVGDNSFSNFLYQYYSTH
KIPKFIIVSELPENQKLLESLLSEQSGFDVKIITPTRGKKKDIIDLLLKNIQLIHSKGGN
PGLVELKEILSLPVIPNIIECFDISNHGEDFAVGSMSRFVGGIPNKNGYRKFKIKTVSGR
DDFAMIGEIIKRRYYRLLEENSELPDLIVIDGGKGQLSSAVKSLESLGLDLPCISLAKEN
EEVYLPKHKNPIIIPKYKSSLKILQHARDETHRFGVAYNRTIRKNQIK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgatatttctaaaatcaatatccctactgatcctggaatatatttgatgaag
gatactgatggaactattatctatattggcaaagcaaagaatttgaaaaatagagtaaaa
tcctatttcaataaaaatcaaaattacaaaacacaaaaactagttgaaaacatttctgat
gttgaatttgttttaactgataatgaaagcgaagcatttcttttagaatcaaacatgatc
aagaaatatcgccctagattcaatattgaattaaaagatcaacaaagatacacatatctt
agaatatctgatgaaaaatatccgcgactgttagtttcaagaagaactagagatggaaaa
tttcttgggaaaggtaagacatttgggcccttcactcaaggtagttctaaactacttaca
attggtacgttaagaaaggcatttcaaattagaatttgtaaaactcttccaaaaaaggtt
tgcttggaatatcatttgggaaattgtgagggtccatgtgaatttaaagatgctcaggaa
agatatcctaaacatgtccaagcattacaagatgttctaaaaggaaaaaatcaaaccaaa
atttttacaaaaaaattgaaagaagagatgcaacaagcagcaaaattacaacaatttgag
cgtgcaaaggatattcgtgacactttgattagactaggaagcttacaaactaaacagaaa
atggagtatgttgaaaattctgatgaagaatactttggcataggtattcaggaacattct
gcaactgtgatgaattttagaatgattaacggtgtgattagagatagtgacaagttcttt
tatgatttagtaggtgataattcgttttcaaatttcttatatcaatattattcgacacat
aaaattcccaaatttatcatagttagtgaacttcctgaaaatcaaaaattgctggaatct
ttgctttcagaacagtctggatttgatgtaaaaatcataactcctactagaggaaagaaa
aaagacatcattgatctgcttttgaaaaatatccaattgattcattccaaagggggcaat
cctggtttagtggaattaaaagaaattcttagtttacctgtaattccaaatatcattgaa
tgttttgatatttctaatcatggtgaagattttgctgtggggtccatgtctagatttgtt
gggggaattccaaacaaaaatggatacaggaaattcaaaattaaaacagtttctggaaga
gatgactttgcaatgattggagaaattattaaaagacgatactatagattgctcgaagaa
aattctgaactccctgatttgattgtgatcgatggaggtaaaggacaacttagttctgca
gtgaagtctttagaatctcttggtttggatttgccttgcatatctttagcgaaagaaaac
gaagaggtataccttcctaaacacaaaaatcctataataattccaaaatacaaatcatct
ctaaaaattttacaacatgcaagagatgagactcatagatttggtgtggcatataataga
acaataaggaaaaatcaaataaaataa

DBGET integrated database retrieval system