KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06420Help
Entry
NSED_06420        CDS       T02303                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase-like FMN-binding protein
  KO
K07005  
uncharacterized protein
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1068652..1069362)
Genome map
AA seq 236 aa AA seqDB search
MMFFKLSCILGILILWIYNIISLNYFMQLTGILQIKSYEKVKEFLNDEHVGRIASIDVNG
FPQIIPMNFVFLNDAVYMHSHVKGEKLDNISRNNKVGFEADRELEFLPSYFEDPHNASLA
DTLYISIVIKGVASFVSDREEKTLALNGLMEKYQPEGKYDPISSDMRVLDAVSVIKVAPQ
TLHGKYKIGQHMSPDDRMNLAQKILKRNSPSALETLKIMGFEVTDTGLKMIDEPVW
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatgttttttaaattatcttgtattttaggaattttaatactctggatttataatatt
atttcattaaattactttatgcagttaactggaattctccaaattaaatcatatgaaaag
gtaaaagaatttttgaatgatgagcatgtaggacgtattgctagcatcgatgtgaatggc
tttcctcaaataatccctatgaactttgtatttcttaatgatgcagtttacatgcattct
catgtaaaaggtgagaaattagataatatttctagaaataacaaagtgggattcgaagct
gacagagagctagaatttttgccctcatattttgaagatccacacaatgcatctttggca
gatacattatacatcagcattgtaatcaaaggagtggcttcttttgtatctgacagggaa
gagaaaacgcttgcactaaacggattaatggaaaaatatcaacctgaagggaagtatgat
ccaattagttctgatatgagggttttagatgctgttagtgtgattaaagttgctcctcaa
acacttcatggaaaatacaaaattggtcaacacatgagtccagatgataggatgaatctt
gcccaaaaaattctaaagagaaattcaccatctgctcttgaaacattgaaaattatggga
tttgaggtaactgatacgggtttgaaaatgattgatgaacctgtatggtga

DBGET integrated database retrieval system