KEGG   Candidatus Nitrosopumilus sediminis: NSED_06440Help
Entry
NSED_06440        CDS       T02303                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K18602  malonic semialdehyde reductase [EC:1.1.1.-]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00720  Carbon fixation pathways in prokaryotes
nir01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    NSED_06440
Enzymes [BR:nir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     NSED_06440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFS83088
UniProt: K0BA30
Position
complement(1071692..1072636)
Genome map
AA seq 314 aa AA seqDB search
MNTVRIPKVINFGENALGETEYPKNALIVTTVPPELSDKWIARMGIKDYMLYDQVKPEPS
IDDVNAVISQFKDKDPSCLIGLGGGSSMDVVKYAAPEMKKEKILIPTTFGTGAEMTTYCV
LKFDGKKKLLREDRFLADMAVVDSYFLEGTPQQVINNSVCDACAQATEGYDSKLGNDLTR
TLCKQAFEILYDAIMNDKPENYPYGSMLSGMGFGNCSTTLGHALSYVFSNEGVPHGYSLS
SCTTVAHKHNKSIFYDRFKEAMEKLGFDKLELKADVSEAADTVMTDRGHLDPNPIPISKD
DVVKCLEDIKTGNL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagtacgcattccaaaagttatcaactttggagaaaatgcacttggtgaaaca
gagtatccaaaaaatgccctaattgtcacaacagttcctcctgaactttctgacaaatgg
attgcaagaatggggattaaagattacatgttgtatgaccaagtaaaacctgaaccatca
atcgatgacgtcaatgctgttatttcacaattcaaagacaaagatccatcatgtctaatt
ggacttggtggtggaagttcgatggatgtagtaaaatatgctgcacctgagatgaaaaaa
gaaaaaatcttaattccaactacatttggaactggagctgaaatgacaacttattgtgtt
ctgaaatttgatggtaaaaagaaattgttacgtgaagacagatttctagccgacatggca
gttgtagattcatacttcttagaaggaactccacaacaagtcataaacaattctgtctgt
gatgcatgtgctcaagcaaccgaaggctatgatagcaaattaggcaatgacttgacaaga
actctttgtaaacaagcatttgagattctatatgatgcaattatgaatgacaaaccggaa
aactatccttatggatcaatgttgtctggaatgggatttggtaactgctctacaacactt
ggacatgcattgtcctatgtgttctcaaatgaaggagtaccacatggatattcgttgtcc
tcttgtactactgttgcacacaagcataacaagtccatcttttatgatagattcaaagag
gcaatggaaaaactaggctttgataaactagaactcaaagctgatgtttcagaagctgct
gacactgtaatgactgatagaggtcatttggatccaaacccaatcccaatatccaaagac
gatgttgtaaagtgtcttgaagatatcaaaacaggtaatttgtaa

DBGET integrated database retrieval system