KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06480Help
Entry
NSED_06480        CDS       T02303                                 

Definition
(GenBank) 5-formyltetrahydrofolate cyclo-ligase
  KO
K01934  
5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
One carbon pool by folate
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NSED_06480
Enzymes [BR:nir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     NSED_06480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1077606..1078169
Genome map
AA seq 187 aa AA seqDB search
MDNNPEKESLRNLLLEKRDNTSFDLMKIASGKIQKKLKKIFAFRDAQKIGAYYPIGSEIF
TQDIIQELLSQGKEVFLPKVIGDSMEFRKISSFSSLEHGSFDIMEPKDDCPVNNNLDVIL
VPTVAISPTGVRLGYGHGFYDKFLAKNKTATISLTLEKQIIKNIPKSEHDVLIDWIVTED
QILQTQR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttggacaataatcccgaaaaagaatcacttcgaaatcttcttttagaaaaaagagacaac
acatcttttgatttaatgaaaattgcaagtggaaagatacaaaaaaaattaaagaaaatt
tttgcgttcagagatgctcaaaaaataggagcatactatccaataggaagtgagatattt
acacaagacatcatccaagaattactcagtcagggaaaagaggtgtttttgccaaaagtc
ataggagattccatggaatttagaaaaattagcagtttttcaagcctggaacatggcagt
tttgacataatggagccaaaagacgactgtccagtaaataacaatctagatgtgattttg
gttccaacagttgcaatatcccctacaggagtaagattaggatatggtcatggattttat
gacaaatttttggcaaaaaacaaaactgcaacaatttcacttacattggaaaaacaaatc
atcaaaaacattccaaaatcagagcatgatgtgctaattgattggattgttactgaagat
cagattctgcaaactcagagataa

DBGET integrated database retrieval system