KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06525Help
Entry
NSED_06525        CDS       T02303                                 

Definition
(GenBank) histidine kinase
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HATPase_c_5 HisKA DUF4242 NPV_P10 DUF3303 HSP33
Motif
Other DBs
NCBI-ProteinID: AFS83105
UniProt: K0BDI0
Position
complement(1086770..1087669)
Genome map
AA seq 299 aa AA seqDB search
MPIFLDMHKLGDYTKEQLIMGLEDKADEFGVTVHQMMFNEKEDILHCICSASDIESVEKH
HMKFNTKCDKIFPIDEIKTDKITKDEKLKVIGELSSRFAHDIRNPLTVIQSSVDILKSKY
PDISKKENVKFDMIKSAIDRIEHQIDDVLGFVASRKLNFNLNNITEILDSSLTGMAIPKK
ISVNKSQNNVPLYCDFESIRVLFVNIILNAIQAMNNFGKIDIKITRDADNVLISFENSGP
SIPEKIIPKIFDPLFTTKQTGTGLGLVSCKQIVDAHGGKIEVTNNPTTFTVILPQKHIS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcctatttttctggatatgcacaaattgggagattacaccaaagagcaattaattatg
ggattagaagataaagcagacgaatttggtgttacagtacatcagatgatgtttaatgaa
aaggaagatatcttgcattgtatttgttctgcctctgatatagaatctgtagaaaaacat
catatgaaatttaacacaaaatgcgataaaatttttccaattgatgaaataaaaactgat
aaaattaccaaagacgagaaattaaaagtgattggggagctttcttctcgatttgcacac
gatattagaaatcctttaaccgttatacaatcctctgtggatattttaaaatcaaaatat
cctgatatatctaaaaaagaaaatgtcaaatttgatatgataaaatctgcaatagataga
attgaacatcaaatagatgatgtattgggatttgtagcctccaggaaactaaattttaat
ttaaacaacataactgaaattttggattcctcgcttacaggtatggccattcctaaaaaa
atatctgtgaataaatcccaaaataatgtccctctttattgtgattttgaatccatacgt
gttctttttgtaaatattattcttaatgcgatacaagcaatgaacaattttggaaaaata
gatatcaaaataactcgagatgcggataatgttttaatctcttttgaaaattctggacct
agcatacctgagaaaataattccaaaaatatttgatcctttgtttactactaaacaaaca
ggtactggtttaggtctagttagttgtaaacaaattgtagacgcgcatggtggtaaaata
gaagtaacaaacaaccctacaacattcactgtaattttacctcaaaaacacatatcataa

DBGET integrated database retrieval system