KEGG   Candidatus Nitrosopumilus sediminis: NSED_06530Help
Entry
NSED_06530        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4082 Dsh_C Vfa1 Peptidase_S49_N
Motif
Other DBs
NCBI-ProteinID: AFS83106
UniProt: K0BFL7
Position
complement(1087779..1088822)
Genome map
AA seq 347 aa AA seqDB search
MNNKTIFVVFFTVSILLLGTISSSVNLIPSADALKGQGVPSSQYGSATKGIVCGDKLCSE
VEQEEKKVEKKIEKKAEKKEQAKTEKKESEKKKLDDKAASEKARYDELSLPPRTIKTGTV
TSTQDPGQGHENHQLAIILPPSDKVYRGIFAFTVSENVQLVTLHGPLKNGEDKGQAIWSP
DGKTKYALTFVPLDASAGTWAFAGNALAVHTMNEDPFTVSYSVAYRERTLSDTVKSETIT
STQDPGQGHENHQLAIILPPRPYAYFGTLGFSASEDVQLVALHGPLQPGQGAHGQAIWTP
DGKTFYALTFVDKETAMGTWQFTGNAVALHTMKDTPFTVSYSIATGQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaagactatttttgttgtattttttactgtctcaatattgttactagggaca
atatccagttctgtcaatcttattccttcagctgatgcattaaagggacaaggagtccca
tcatcacaatatggttctgccacaaaaggaattgtctgtggagacaaattatgttctgaa
gtggaacaagaagaaaagaaagtagaaaagaaaatagaaaagaaagcagaaaaaaaggaa
caagccaaaacagaaaagaaagaatctgaaaaaaagaaattagatgacaaagcagcatct
gaaaaagcaagatatgatgaattgtcattaccgcctagaacaataaaaactggaactgtc
acgtctacacaagatcctggacaaggacatgaaaatcatcaattagcaataatcttacct
ccttctgataaagtatatcgtggaatatttgcattcactgtctctgaaaatgttcaactg
gtaacccttcatggccctctgaaaaatggtgaagacaagggacaagcaatttggtctcca
gatggtaaaacaaaatatgctttgacttttgttcctttagatgcctccgcaggaacttgg
gcatttgctggtaatgctttggccgtgcataccatgaatgaagatccatttactgtttca
tactcggttgcatatagagaaagaactctctctgatactgtaaaaagtgaaaccatcacg
tctacacaagatcctggacaaggacatgaaaatcatcaattagcaataatcttgcctcct
aggccttatgcttattttggaactttgggattctctgcatctgaagatgttcagttagta
gcactccatggtccattacaaccgggtcaaggtgcacatggacaagcaatctggacccct
gatggaaaaacattctatgcattaacttttgtagataaagaaactgcaatgggtacttgg
caatttactggtaatgccgttgcattacacacaatgaaagatactccatttaccgtaagc
tattctatagctactggccaatag

DBGET integrated database retrieval system