KEGG   Candidatus Nitrosopumilus sediminis: NSED_06555Help
Entry
NSED_06555        CDS       T02303                                 

Definition
(GenBank) inorganic diphosphatase
  KO
K01507  inorganic pyrophosphatase [EC:3.6.1.1]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    NSED_06555
Enzymes [BR:nir01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     NSED_06555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyrophosphatase S-layer
Motif
Other DBs
NCBI-ProteinID: AFS83111
UniProt: K0BFM0
Position
1097522..1098061
Genome map
AA seq 179 aa AA seqDB search
MSKNFWHDIESGTDIPEIINAIVEIPKGSMNKYEYDKKHNMIKLDRVLFSPFHYPGDYGL
IPQTLSDDGDPLDALVLVTNPTYPGILIEARPIGLLQMKDDGKLDDKIICVATNDPRYLH
TTDITDIEDHYRSEIAHFFQVYKDLEGKKVEILGWKSAKEAKTVIIESIKRYRDTLKKY
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaatttttggcacgacatagaatcaggtacagacattcctgaaatcattaat
gcaattgtagagattcccaaaggctctatgaacaagtacgaatatgacaaaaaacacaac
atgataaaattagacagagtgttattttcaccatttcattatccaggagactatggtctc
atccctcaaacattatcagatgacggggatccattggacgcattagtattggttacaaat
cccacatacccaggaatcttaattgaagcaaggccaatagggctccttcaaatgaaggat
gatggaaaactagatgacaaaattatttgtgttgcaacaaacgatccaagatacctacac
actacagacattacagacattgaagatcattatcgttctgaaattgctcactttttccaa
gtttacaaagatttggaaggaaagaaggtagaaattttaggatggaagtctgcaaaagaa
gcaaaaacagtaatcattgaatcgataaaaagatacagagacactttgaaaaaatattaa

DBGET integrated database retrieval system