KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06570Help
Entry
NSED_06570        CDS       T02303                                 

Definition
(GenBank) transcription factor TFIIB cyclin-related protein
  KO
K03124  
transcription initiation factor TFIIB
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Basal transcription factors
Brite
KEGG Orthology (KO) [BR:nir00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NSED_06570
Transcription machinery [BR:nir03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     NSED_06570
 Prokaryotic type
  Archaeal type
    TFB
     NSED_06570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1098944..1099891)
Genome map
AA seq 315 aa AA seqDB search
MVLHLVLEIINADSTCGRCGKNSMLTDNVTGERFCGKCGYVITETLQDSGPEWRSFSKEG
GADPTRTGAPTSLAMHDRGLATIISPMNKDSSGKPLTSTMKSTIERLRTWDSRSKVNASS
DKNLRQALSELSTLKDKLSLSDAVIEKASYIYRKALEKGLVKGRSISALIAASLYAACRD
TETPRTLKDVSDAGNIKKKDISRCYRILHQELELKMPVVDPVQCVARIASSIGITEKTKR
YAVKVLKDAQAHEESAGKDPMGLAAAALYLSCVKNGEDKTQRDIAEAANVTEVTIRNRYK
GLRLDQNMDMLGGKS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtattacacttggttttagaaattattaatgctgattcgacatgcggtcgttgcgga
aaaaattccatgctgactgataatgtcactggtgaaagattctgtggtaaatgcggttat
gtgatcactgagactctacaagactccggccctgaatggagatcattttcaaaagaaggt
ggtgcagatccaacaagaactggagctcccacatcgcttgcaatgcatgacagaggactt
gcaacaattatcagtcctatgaataaggactcttctggaaaacctctgacctctaccatg
aaaagtacaattgaaagattgagaacttgggatagtagaagtaaagtaaatgcttcttca
gataaaaatctcagacaagcactaagtgaattatctacattaaaagacaaactttcatta
tctgatgcagttattgaaaaagcatcatacatttacagaaaagccttagaaaaaggtctt
gtaaaaggtcgttctatatctgcattaattgcagcttctctttatgctgcatgtagagac
actgaaacccctagaactctaaaagatgtttcagatgcaggtaatattaagaaaaaagac
atttcaagatgttatagaattttacatcaggaattagaactaaaaatgcctgttgtggat
cctgttcaatgtgttgcaagaattgcaagctctattggaattactgaaaaaacaaaacgt
tatgcagttaaagtactcaaagatgcacaagcacatgaagagtctgcaggaaaagatcct
atgggattagctgctgcggcattatacctttcttgtgtcaaaaacggtgaagataaaact
caacgtgatattgcagaggccgcaaatgttactgaagtaacaattagaaatagatacaaa
ggcttgagattagatcaaaatatggatatgctgggaggaaaatcataa

DBGET integrated database retrieval system