KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_06645Help
Entry
NSED_06645        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sp. AR2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1112767..1112949
Genome map
AA seq 60 aa AA seqDB search
MRVDSCRKCGMELTIKQECSICNEPIKFSCKECYFEPEEQIHSLCKLVDMNHKPLISETA
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgatagttgtagaaaatgtggaatggaactaacaatcaaacaagaatgttca
atttgtaatgaaccaatcaagttcagttgcaaagaatgctattttgaaccagaagagcaa
attcattcattatgcaaattagtagatatgaatcataaaccattaatttcagaaacagca
taa

DBGET integrated database retrieval system