KEGG   Candidatus Nitrosopumilus sediminis: NSED_06675Help
Entry
NSED_06675        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CopG_antitoxin RE_BstXI
Motif
Other DBs
NCBI-ProteinID: AFS83133
UniProt: K0BA64
Position
1118309..1118842
Genome map
AA seq 177 aa AA seqDB search
MSEEQKRKTETMSFRLDSHVLDKIRAESESEGVSLNVLANKIFSRYVDWDMFEPKVGMIP
VAKPIVSALFQKLSEQETIELAKQIGQSIVSDISTFMKGSMDIDSFVSWFVTRMKISDFD
MNHTINDSKHTYIIKHDLGYNWSLYHKTVLELIFNNVLEKKIDFQIKEMMMEISFEK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagaagaacaaaaaaggaaaacagagacgatgtcatttagactagacagtcatgtt
ttagataagataagagcagaatcagaatctgaaggggtaagcttgaatgttttagcaaac
aagatattttcaagatatgttgattgggacatgtttgagcctaaagtaggcatgattcca
gtagcaaagcccatagtcagtgcattgtttcaaaagctttcagaacaagaaacaattgaa
ctagcaaagcagattggtcaaagtatcgtatcagacatctctacattcatgaagggttct
atggatattgattcgtttgtgtcttggtttgtaacaagaatgaaaatatcagattttgat
atgaaccacacaataaatgattcaaaacacacctacattataaaacatgatttagggtat
aactggtcattatatcataaaacagtgttagaattaatttttaacaacgtattggaaaaa
aagatagattttcaaatcaaagagatgatgatggaaatatcttttgaaaaatga

DBGET integrated database retrieval system