KEGG   Candidatus Nitrosopumilus sediminis: NSED_06765Help
Entry
NSED_06765        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFS83151
UniProt: K0BFP8
Position
complement(1134050..1134511)
Genome map
AA seq 153 aa AA seqDB search
MILWKLESDEGFFRIYDSKKLIAGYFDPDYGDVLSKDNSEDIILSMMKNHDKILGGVIMV
PLVKFRLFDTDLDTSLTNVEEQVIRVNEHLQKWKNFLSETNLRSHSIRISHTDQDMLTIS
FPITFSKPTPLEKTSLCEELLETLELLQKSGLL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgatattgtggaaattagaatctgatgaaggtttttttcgaatatatgattcgaaaaaa
ctcattgctggatattttgatcctgactatggcgatgttttatcaaaagataattccgaa
gatattattttatctatgatgaaaaatcatgacaaaatcttaggtggggtcattatggtt
ccgcttgtaaaatttagactatttgatactgatttggatacatctttgacaaatgttgaa
gaacaagtaatacgagtaaatgaacatttgcaaaaatggaaaaatttcttatctgaaact
aatcttcgatctcattcaattagaatatctcacactgatcaagatatgcttacgatatct
tttcccattactttttctaaacctactcctcttgaaaaaacatcattatgtgaggaactt
ttggaaaccctggaattattgcaaaaatccggcttgctgtaa

DBGET integrated database retrieval system