KEGG   Candidatus Nitrosopumilus sediminis: NSED_06795Help
Entry
NSED_06795        CDS       T02303                                 

Definition
(GenBank) hypothetical protein
Organism
nir  Candidatus Nitrosopumilus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1978 MutS_II
Motif
Other DBs
NCBI-ProteinID: AFS83157
UniProt: K0BDK1
Position
1139169..1139405
Genome map
AA seq 78 aa AA seqDB search
MDKHKPSDEMIKDLDNLLSKLNAMEIVASNEFEKNSIKIQRALVEGQMHSINEFQHLKKA
LDLLTLQLFDVQNKINES
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacacaaaccatcagacgagatgattaaagatttggataatttgttatcaaaa
cttaacgccatggaaattgttgcctcaaatgagtttgaaaaaaattcaattaagattcaa
agagccttagttgaaggtcagatgcattcaataaatgaatttcagcatttgaaaaaagca
ttagatttgttaactctgcaactgtttgatgttcaaaataagatcaatgaatcctag

DBGET integrated database retrieval system