KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_08025Help
Entry
NSED_08025        CDS       T02303                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NSED_08025
Enzymes [BR:nir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NSED_08025
Peptidases [BR:nir01002]
 Cysteine Peptidases
  Family C44
   NSED_08025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1343846..1344601)
Genome map
AA seq 251 aa AA seqDB search
MDEMNKKLLDNIKNSISETVKVKKIGIAFSGGVDSTLISKICSDMNFDVTLLTIGFSESH
DILFAKHVNEFLKYPHHVLEIDPDTFPSISTKINQIINTENLSWNENCIAFHYVSKLANS
LDLDTVITANGIDELFCGYNAYREAFSGGESKINEVMAAKLDNELKMMKAVNLVASEFGV
KIFQPLLSPKFIEYANTVPMYEKIHDSDDLYRKHIIRKLASEVGVPELSYTKRKKALQYG
TKIHKSLLKTR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaatgaacaaaaaattactcgataatatcaagaattctatttctgaaactgtt
aaagtaaagaaaattggaattgctttttcgggtggagttgatagcacgttaatttcaaaa
atttgctcagacatgaattttgatgtcacattacttacaattggattttcagaatcgcat
gatattttattcgcaaagcatgtcaatgaatttctaaaatatcctcatcatgttctagaa
attgatccagatacttttccatcgatttctacaaaaattaatcaaataataaatactgag
aatctatcttggaatgaaaattgtattgcttttcattatgtttcaaaacttgcaaactct
ttagatcttgatactgtaattactgcaaatggaatagatgaattgttttgtggttacaat
gcatacagagaagcattctctggaggagaatcaaaaatcaacgaagtaatggctgctaaa
ttagataacgaactaaaaatgatgaaagcagtcaatctagttgcatctgaatttggagta
aaaatattccagccattactatccccaaaattcattgaatatgcaaatactgttcctatg
tatgaaaaaattcacgattcagatgatctataccgcaagcacattatacgaaaactagcc
agcgaagtcggtgtaccagaactttcttacactaaacgaaaaaaggcattgcaatacgga
actaaaattcacaaatctttacttaaaactagataa

DBGET integrated database retrieval system