KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_08980Help
Entry
NSED_08980        CDS       T02303                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nir00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nir00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1513407..1514336)
Genome map
AA seq 309 aa AA seqDB search
MNEFYQKDIISIKDYTKEQLETIFTSTDKILNLSPFDRREICKGKTLGYLFYEPSTRTRL
SFDSAMASIGGNSLGISDITSSSTQKGESLADTVRIMSIYSDILVLRHPLDGSSRFAAEI
SDKPVINAGSGTEEHPTQAIQDLFTIKKEKKKIDGLKIGIVGDLKYGRTVYSLLHGLGNY
DVDVRLISPESLRIRSDSTYEIKKRLDLTETTDIEEHLDDLDVLYVTRIQKERFPDEEEY
LKVKGSYVVGLDMLKRMKDDAIILHPLPRIDEISADVDKTKNAKYFEQAEYGKYTRSALL
GMIINENGF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagttctaccaaaaagacataatctcgattaaggactatactaaagaacaatta
gaaactatctttacatccactgataaaatccttaatctgagcccctttgatagaagagaa
atttgtaaaggaaaaacattaggatatttgttttatgaaccaagtaccagaactcgttta
agttttgattcggctatggcctcaattggtggcaactcattgggaatttctgatattaca
tcttcatccactcagaaaggtgagagtcttgcagatactgttaggattatgtcaatttat
tcagatattcttgttttacgtcatcctttggatgggtcaagtagatttgcagctgaaatt
tctgataaaccagtaatcaatgcaggtagtggaactgaagaacatccaactcaagcaatt
caagatttgtttacaatcaaaaaagaaaagaaaaagattgatgggctaaaaatcggaatt
gtaggggatttaaaatatggtcgcacagtatattctctattacatggactaggaaattat
gatgtagatgtaagattgatttctcctgaatcactaagaataagatcagattcaacttat
gaaattaaaaaaagattagacttgactgaaactactgacattgaagaacatctagatgat
cttgatgttctctatgtcacaagaatccaaaaagagagatttcctgatgaagaagaatat
ctcaaagttaaaggaagttatgttgtaggattagatatgttaaaaagaatgaaagacgat
gccataattttacatccactgccaagaatagatgaaatttcagctgatgttgacaaaaca
aaaaatgccaaatattttgagcaagccgaatatggaaaatatactcgttctgcactatta
ggtatgattatcaatgaaaatggattttaa

DBGET integrated database retrieval system