KEGG   Candidatus Nitrosopumilus sp. AR2: NSED_09815Help
Entry
NSED_09815        CDS       T02303                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nir  Candidatus Nitrosopumilus sp. AR2
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nir00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NSED_09815
Enzymes [BR:nir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NSED_09815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1651584..1652141
Genome map
AA seq 185 aa AA seqDB search
MDQERVKKLVRELIIEVGEDPTREGLRETPERIANMYKEIFSGYDSDSELSVQFSEDSDV
VIARDIQFYSMCEHHMLPFYGKIHIAYSPNGRVFGISKLVRLVEKYSKRLQIQERLTKNI
ADELHSQGVKGVVVLADAEHLCMKMRGVKNDATLSSSAFRGIYENKEEKAGIMSLIRQRS
SDLPF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggaccaagagcgtgtaaaaaaactcgttagagaattaatcattgaagttggtgaagat
cctacacgtgagggattacgggagactcctgaaagaattgcaaatatgtacaaagaaatc
tttagtggatatgattctgattcagaattatcagtccaattctcagaagactctgatgta
gtaattgctcgtgacattcaattttattcaatgtgtgaacaccatatgttgcctttttac
ggcaaaattcacattgcatactctccaaatggcagagtttttggaatatcaaaacttgtt
agactagttgaaaaatattcaaaaagactccaaatacaagaacgattgacaaaaaatatt
gctgatgagctacactctcagggagtaaaaggagtagttgttttagctgatgcagagcac
ctttgtatgaaaatgcgtggcgtcaaaaatgatgctacactttcctcatctgcattcaga
ggcatttatgaaaataaagaagaaaaggcaggcattatgtctctaatcagacaacgttcc
tctgatttgcccttttag

DBGET integrated database retrieval system