KEGG   Nitratiruptor sp. SB155-2: NIS_0246Help
Entry
NIS_0246          CDS       T00565                                 

Gene name
rpsM
Definition
30S ribosomal protein S13
Orthology
K02952  
small subunit ribosomal protein S13
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Ribosome
Class
Genetic Information Processing; Translation; Ribosome [PATH:nis03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237659..238021
Genome map
AA seq 120 aa AA seqDB search
MARIAGVDLPKNKRIEYALPYVYGIGLTTSRKILDAVGISYDKRVYELTEDEVAAINKHI
RENYMVEGDLRRKVAMDIKALMDIGCYRGLRHRRGLPVRGQRTKTNARTRKGKKKTVGAK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggattgcaggcgtagatttaccaaaaaataaacgaatagagtatgcacttcca
tatgtttatggaattggattgacaacatctcgaaaaattcttgatgctgttggcatcagc
tacgataaaagagtttatgaactcactgaagatgaagtagctgctatcaacaaacatatc
cgtgaaaactatatggtcgaaggtgatcttcgaagaaaagtagctatggatatcaaagcg
cttatggatatcggatgttatagaggccttcgacatagacgtggtcttcctgttcgagga
caaagaacgaaaacaaatgctcgaacacgaaaaggtaagaaaaaaacagtaggtgctaaa
taa

DBGET integrated database retrieval system