KEGG   Nitratiruptor sp. SB155-2: NIS_0246Help
Entry
NIS_0246          CDS       T00565                                 

Gene name
rpsM
Definition
30S ribosomal protein S13
Orthology
K02952  
small subunit ribosomal protein S13
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:nis00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    NIS_0246 (rpsM)
Ribosome [BR:nis03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    NIS_0246 (rpsM)
  Archaea
    NIS_0246 (rpsM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237659..238021
Genome map
AA seq 120 aa AA seqDB search
MARIAGVDLPKNKRIEYALPYVYGIGLTTSRKILDAVGISYDKRVYELTEDEVAAINKHI
RENYMVEGDLRRKVAMDIKALMDIGCYRGLRHRRGLPVRGQRTKTNARTRKGKKKTVGAK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggattgcaggcgtagatttaccaaaaaataaacgaatagagtatgcacttcca
tatgtttatggaattggattgacaacatctcgaaaaattcttgatgctgttggcatcagc
tacgataaaagagtttatgaactcactgaagatgaagtagctgctatcaacaaacatatc
cgtgaaaactatatggtcgaaggtgatcttcgaagaaaagtagctatggatatcaaagcg
cttatggatatcggatgttatagaggccttcgacatagacgtggtcttcctgttcgagga
caaagaacgaaaacaaatgctcgaacacgaaaaggtaagaaaaaaacagtaggtgctaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system