KEGG   Nitratiruptor sp. SB155-2: NIS_0253Help
Entry
NIS_0253          CDS       T00565                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nis00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nis00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
241446..242738
Genome map
AA seq 430 aa AA seqDB search
MICTFENITVTDHSKSIQDADYFLITQQNRQYVTDIPKEKIITPQDLINRYRLDTLKTIG
VTGTNGKTTTAAAIYSYLNDLGLKAALQGTRGFFIEDEQLEKKSLTTPPILQTLYHMYTA
KQQGATYFVMEVSSHAIAQNRIEDLQFALKVFTNISQDHLDYHKTMQNYIATKSSFFMDE
GSKLINKDDKHIQYNPKGARTYSVEELATYQILAFSMQNGISAVLRFGNEMIDFHAPMIG
LFNLYNVTAAISAVHMLTNLPLQQICEVTEHFAGVKGRMQILNEEPLIIVDFAHTPDGMQ
KVFESFPGKKLVAIFGAGGDRDRSKRALMGNVASRFCTKIYLTSDNPRSEDPKQIIEDIA
KGIETDVFVEKIVDRKEAVEKAFHSLQKDEILLILGKGDEEYIEQNGTKIPYSDVEVVTD
IIEDLNERGT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtacatttgagaacataactgtcacggatcattccaaatccattcaggatgcg
gactattttttaatcacacaacaaaatcggcaatacgttacagatataccaaaggaaaaa
attataactccccaggatttaatcaatcggtatcggctggacactcttaaaaccattggc
gttacagggacaaatggaaaaactacaactgcagctgccatctattcctatcttaatgat
cttggattgaaagcagcattacaagggaccaggggattttttatagaggatgagcaactt
gaaaaaaagtctttgactacccctccaattttacaaacactgtatcatatgtatactgca
aaacaacagggagcgacatattttgtcatggaagtcagttcccatgctattgcacaaaat
agaatcgaagatcttcagttcgcactgaaagtgtttaccaatatttcacaagatcacttg
gactatcacaaaaccatgcaaaactatattgctacaaaaagcagtttttttatggatgaa
gggtcaaaacttattaacaaagatgataagcatatccaatacaatccaaagggtgcaaga
acatacagcgttgaagagcttgctacctatcagatcctggccttttcaatgcaaaacggg
atcagcgctgtacttcggtttggcaatgagatgatcgattttcatgcgccaatgatcggt
ctatttaatctctataatgttactgcagcaataagcgcagtacatatgttgacaaacttg
cctctgcagcagatttgtgaagtaacagaacattttgccggtgtcaaaggccgaatgcag
attctcaacgaagagccgttaattattgtcgattttgcccatactccagatggtatgcaa
aaagttttcgagagctttccaggaaaaaaattggtagcaatatttggcgcgggtggagat
agagacagaagtaaacgagcactgatggggaatgtggccagtaggttttgtaccaaaata
tatcttacttctgacaatccacgaagtgaagatccaaaacagattatcgaagatattgca
aaaggtatagaaacagatgttttcgtggaaaaaatcgttgatagaaaagaagcagtcgaa
aaagcgttccattcattacaaaaagatgaaattcttttgattcttggtaaaggagatgaa
gagtacattgaacaaaatggtacaaagataccatatagcgatgtcgaagtagtcacagat
attatagaagatttgaatgaaagaggcacttaa

DBGET integrated database retrieval system