KEGG   Nitratiruptor sp. SB155-2: NIS_0273Help
Entry
NIS_0273          CDS       T00565                                 

Gene name
cheB
Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:nis02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:nis02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265347..266432
Genome map
AA seq 361 aa AA seqDB search
MKKSPKALVIDDSALVRRFLKKELERLGFEVDVAKDGEEGEKKALENQYDLITLDIEMPK
KNGLDVLRSIMEKNPTRVLIVSTYAVENGDIAMNALQLGALDYITKPDQRLATAGNEFIK
EFEFKINELMKINKISLLTRKKRFSSIYTPVIEQATEFAPKDDKKYVLVGASTGGPKLIE
AIARSLPENYPYPVCVVQHMPPTFTGKFAERLDSISKIKVLEAKNGEELTPAKMIIGKGG
KHLHFRRDGNKVVCKLVPNTNNRFFVPSVDEMFFSALEVMNPKNIMAVLLTGIGDDGADG
MVALKKAGAYTIAESEESATVYGMPKEAYVRGGTVKVLPFDEILQEIIAFGSKNDIKKDG
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagcccaaaagcgctcgttattgatgattcggcattggtccgaagatttttg
aaaaaagagttggaacggctcggattcgaggtagatgtcgcaaaagatggtgaagagggt
gagaaaaaagctttagagaatcaatatgatcttattacactcgatatcgagatgcccaag
aaaaatgggttggatgtgttacggtccattatggagaagaatcctacacgagttctcatt
gtaagcacgtatgctgttgagaatggcgatatagcaatgaacgctcttcagttgggagca
ttggattatataacaaaacctgatcaaagattggcaacggctggaaatgagtttataaaa
gagtttgaatttaagataaatgaacttatgaaaatcaacaagatttctcttttaacaaga
aaaaagaggttctcttctatatatactccggttatagaacaagcgacagagtttgctccc
aaagatgataaaaaatatgtacttgttggtgcctcaaccggcggtccaaaacttattgaa
gcaattgcgcgatctttgcctgaaaactatccctatcctgtgtgtgtggtacagcatatg
ccaccgacatttactggaaagtttgctgaaagacttgatagtattagtaaaataaaagtg
cttgaagctaaaaatggtgaagaactcacacccgcaaagatgatcataggcaagggcgga
aagcatcttcattttcgaagagacggtaataaggtggtttgtaagcttgttccaaataca
aataaccgtttttttgtaccgagcgtggatgagatgttttttagtgcgttggaggtgatg
aatccaaaaaacatcatggcagtactgttaactggaattggtgatgatggtgcagatgga
atggtggctttgaaaaaagcaggtgcttatacaatagcagaaagtgaagagagtgcgacg
gtctatggaatgccaaaagaggcatatgtaagagggggaacagtaaaagttttgcccttt
gatgagattttacaagagataattgcttttgggagtaaaaatgacattaaaaaagatgga
agataa

DBGET integrated database retrieval system