KEGG   Nitratiruptor sp. SB155-2: NIS_0360Help
Entry
NIS_0360          CDS       T00565                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NIS_0360 (hemB)
Enzymes [BR:nis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NIS_0360 (hemB)
Exosome [BR:nis04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NIS_0360 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
348386..349351
Genome map
AA seq 321 aa AA seqDB search
MFKRFRRLRLNPVMRNLVQETRLSVNDFIYPLFVRSGEGIKKEVDSMPGVYQMSIDEVVK
ECEELKKLGLYAVILFGIPDVKDSVGSEALCESGIIARAIKAIKEAHPDMFVVTDLCFCE
YTDHGHCGVLDPKLQTVDNDATLELLAKQAVVHAKAGSDMIAPSGMMDGMIAAIRAGLDA
AGFSHIPIMSYSTKFASAYYGPFRDVAESAPSFGDRRSYQMNPANRREAVLESIEDETEG
ADILMVKPALAYLDIVRDIREASMLPLAVYNVSGEYSMLKMAARAGVIDYEKVMMETLLG
FKRAGADIIITYHAKEAAKLL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgttttcgaaggctcaggctcaatcctgtaatgagaaaccttgtccaagag
acgaggctcagtgtcaatgactttatctatcctctgtttgtccgaagtggcgaagggatc
aaaaaagaggtggactcgatgcccggagtctaccagatgagtatcgatgaagtggtaaaa
gagtgcgaagagttgaaaaaacttgggctctatgcagtgattctttttggcattcccgat
gtgaaagatagtgttggcagtgaagcgctttgtgagtcaggaatcattgcgcgtgctatc
aaagcgatcaaagaggcacatcccgatatgtttgtggtgacagatctttgtttttgcgaa
tataccgatcatggtcattgtggagtactcgatccgaaactccaaacggtagataacgat
gccactcttgagctgttggcaaaacaggctgtagtccatgcaaaagccgggagtgatatg
atcgctccaagcgggatgatggatggaatgattgccgctatcagagcggggcttgatgca
gcaggatttagccatattcctatcatgagctattcgacaaagtttgccagtgcctactat
ggaccgtttcgtgatgtggcagagtctgctccaagttttggggatagaagaagctatcag
atgaatccggcaaacaggagagaagcggtactggaaagcatagaggatgaaacagaaggt
gcagatatattgatggtcaaaccggccctagcatacctggatatcgttcgagatatcagg
gaagcttcgatgcttccgttggctgtatacaatgtaagcggggagtattcgatgctgaag
atggctgctcgagcaggggtgatcgattatgaaaaggtgatgatggagacgcttcttggt
ttcaaacgtgcaggtgcggatatcatcatcacctaccatgcgaaagaggctgcaaaactg
ctataa

DBGET integrated database retrieval system