KEGG   Nitratiruptor sp. SB155-2: NIS_0555Help
Entry
NIS_0555          CDS       T00565                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NIS_0555
   00052 Galactose metabolism
    NIS_0555
   00500 Starch and sucrose metabolism
    NIS_0555
   00520 Amino sugar and nucleotide sugar metabolism
    NIS_0555
Enzymes [BR:nis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NIS_0555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553778..554602
Genome map
AA seq 274 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAIPKEMLPIVNKPLIQYGVEEAIEAGMDTMAIITGRGKR
AIEDHFDISYELEHQIKGTSKEYLLKYIRSLVENYTFTYTRQKQMKGLGHAVLVGQTLIG
NEPFGVVLADDLCEGEGKGVLAQMVELYHKYKTSIVAVMEVEQKDVSKYGIISGKEIDED
IFMVEDMIEKPSVEEAPSNLAVIGRYILTPDIFTILERTKPGAGGEIQLTDALKVQAKKN
MVIAYRFKGKRFDCGSVEGYVEATNYFYHKFTQK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaagtgtttgtttccagctgcaggatatggcaccaggtttttaccggcgaca
aaagcgattccaaaagagatgctcccgatagtcaacaaacctttgatccagtatggtgta
gaagaagcgatcgaagcgggaatggatacgatggctatcattacaggtcgggggaaaagg
gcgatagaggatcattttgacatcagttatgaacttgaacatcagatcaaaggaacttcc
aaagagtatcttttgaaatatattcgaagtctagtggaaaactacacctttacttatacc
cgtcaaaagcagatgaaggggctgggacatgcggtgcttgtgggccaaacgctcatagga
aacgagccttttggtgtagtgcttgcagatgacctttgtgaaggtgaaggcaagggtgtg
cttgctcagatggtagaactctatcacaaatataaaacttccatcgtggcagtaatggaa
gtggagcaaaaagatgtcagtaagtatgggattatcagcggtaaagagatcgatgaagat
atatttatggtagaggacatgatagagaagccttctgttgaagaggctccaagcaatctg
gccgttatagggcgctacattcttacaccagacatatttactatccttgaacgtacgaag
ccgggagctggcggagagatccagttgacggatgctttgaaagtacaggctaagaagaac
atggtcatagcctatagattcaaagggaaacgatttgactgtggaagtgtagaggggtat
gtggaggcgacaaactacttttatcataaatttacccaaaagtag

DBGET integrated database retrieval system