KEGG   Nitratiruptor sp. SB155-2: NIS_0555Help
Entry
NIS_0555          CDS       T00565                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NIS_0555
   00052 Galactose metabolism
    NIS_0555
   00500 Starch and sucrose metabolism
    NIS_0555
   00520 Amino sugar and nucleotide sugar metabolism
    NIS_0555
Enzymes [BR:nis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NIS_0555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553778..554602
Genome map
AA seq 274 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAIPKEMLPIVNKPLIQYGVEEAIEAGMDTMAIITGRGKR
AIEDHFDISYELEHQIKGTSKEYLLKYIRSLVENYTFTYTRQKQMKGLGHAVLVGQTLIG
NEPFGVVLADDLCEGEGKGVLAQMVELYHKYKTSIVAVMEVEQKDVSKYGIISGKEIDED
IFMVEDMIEKPSVEEAPSNLAVIGRYILTPDIFTILERTKPGAGGEIQLTDALKVQAKKN
MVIAYRFKGKRFDCGSVEGYVEATNYFYHKFTQK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaagtgtttgtttccagctgcaggatatggcaccaggtttttaccggcgaca
aaagcgattccaaaagagatgctcccgatagtcaacaaacctttgatccagtatggtgta
gaagaagcgatcgaagcgggaatggatacgatggctatcattacaggtcgggggaaaagg
gcgatagaggatcattttgacatcagttatgaacttgaacatcagatcaaaggaacttcc
aaagagtatcttttgaaatatattcgaagtctagtggaaaactacacctttacttatacc
cgtcaaaagcagatgaaggggctgggacatgcggtgcttgtgggccaaacgctcatagga
aacgagccttttggtgtagtgcttgcagatgacctttgtgaaggtgaaggcaagggtgtg
cttgctcagatggtagaactctatcacaaatataaaacttccatcgtggcagtaatggaa
gtggagcaaaaagatgtcagtaagtatgggattatcagcggtaaagagatcgatgaagat
atatttatggtagaggacatgatagagaagccttctgttgaagaggctccaagcaatctg
gccgttatagggcgctacattcttacaccagacatatttactatccttgaacgtacgaag
ccgggagctggcggagagatccagttgacggatgctttgaaagtacaggctaagaagaac
atggtcatagcctatagattcaaagggaaacgatttgactgtggaagtgtagaggggtat
gtggaggcgacaaactacttttatcataaatttacccaaaagtag

DBGET integrated database retrieval system