KEGG   Nitratiruptor sp. SB155-2: NIS_0566Help
Entry
NIS_0566          CDS       T00565                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00340  Histidine metabolism
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01230  Biosynthesis of amino acids
Module
nis_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    NIS_0566 (hisD)
Enzymes [BR:nis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NIS_0566 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Glyco_hydro_67N
Motif
Other DBs
NCBI-ProteinID: BAF69680
UniProt: A6Q2H1
Position
563317..564609
Genome map
AA seq 430 aa AA seqDB search
MRILETKSSTFSKEFETILARAQEDNEWVMPIVTKIIDEIKRDGDKALFEHIAKFDHWQP
RTSDDLKIDQNLMQKAYEALDEKLRDALHLAYDRIKRYHEKQLPKSWVDFEKNGTILGQK
VTPVEKAGLYIPGGKAAYPSSLLMNAIPALVAGVDEIVVTTPTPHNEPNHLLLAACHLCG
IEKVYKVGGASAIAALAYGTESIPKVDVITGPGNIFVATAKRLVFGEVNIDMVAGPSEIG
IIADSSANPRYVAIDLLSQAEHDEMASSILITDSSDLAQSVNDEVELFLENLQRKEIAQK
SIDERGAIIVASSMDEAVELMNTIAPEHLEIMTANPFDLLSKIKHAGAIFLGENTPEPIG
DYIAGPNHTLPTGGTARFYSPLNVEHFMKKSSIINFSHQAMQEIGEAAAILAHTEGLEAH
AKSIEERLEK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagaatacttgaaacaaaatccagcactttttctaaagaatttgaaacaattttagca
cgggctcaagaagataatgaatgggtaatgccaattgtcacaaaaataatagatgagata
aaacgtgatggagacaaagcactgtttgagcatattgcaaaatttgatcattggcagccc
cgaacgagtgatgatctaaagattgatcaaaatttgatgcaaaaagcatacgaggcattg
gatgaaaaattaagagatgcgcttcatttagcctacgaccgtattaagagatatcatgaa
aagcagcttccaaaatcatgggtcgattttgaaaagaacggaacaatcctagggcaaaaa
gtgacgcccgtcgaaaaagcagggctctatattccgggagggaaagccgcctacccgagt
agtctgcttatgaatgccattccggcacttgtggcaggagtggacgagatcgttgtcacg
acgcctacaccacacaacgaaccaaaccatctattattggctgcttgccatttgtgcggt
attgaaaaagtgtataaagtgggtggtgcaagcgctatagccgctttggcgtatggcacc
gagtcgataccgaaagtggatgtgattacaggaccgggcaatatttttgtagcgacggcc
aaaagactcgtttttggcgaagtgaacatcgatatggttgcaggtccaagtgaaatcggc
attattgctgatagcagtgccaatccaagatatgtggctatcgatctactcagtcaagcg
gaacatgatgagatggcgagctctattttgataacagattcgtccgatcttgcacaatcg
gtcaatgatgaggtagagctctttttagaaaatcttcaaagaaaagagattgcccaaaaa
tcgattgatgagaggggggctattatcgttgcgtccagtatggatgaagccgttgaactt
atgaataccatcgctcctgaacaccttgagatcatgacagccaatccttttgatctgctt
tcaaaaatcaaacatgccggtgctatctttttaggcgagaatacgcctgagccgattggt
gattacattgcaggacccaatcacactttgccaacgggtggaacggcaagattttattca
ccacttaatgttgagcactttatgaaaaagagctctatcatcaatttttcccaccaagcg
atgcaggagattggagaagctgctgctatattggcgcataccgaagggctggaggcccat
gcaaaatctatagaggagcggctggaaaaatag

DBGET integrated database retrieval system