KEGG   Nitratiruptor sp. SB155-2: NIS_0652Help
Entry
NIS_0652          CDS       T00565                                 

Definition
ATP citrate synthase, subunit 1 (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIS_0652
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIS_0652
Enzymes [BR:nis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     NIS_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649217..650548
Genome map
AA seq 443 aa AA seqDB search
MAQRAIREYDGKKLFAQNWDKYFKGLKYPFESVLVTSGDELKKKAEEPGYEWLKTKPLVA
KPDMLFGKRGKNNLVLFKVNKPGDVTLEDAAKWIDEKRNQETTLLSGQKGVLTHFIVEPF
TPHSEDEEYYIAATTLDENYDVLYMSAHGGMEVEENWDKVTEVKIPINASDEEIEKLIKE
NIPADIPEDKKEVYANFAVNFYKFFRDLNFAYLEINPVVIVGDNVYLLDLVARLDDTAGF
LMKDVWGDIEFPTPFGMPEKSPEEKAIAEADAKSGASLKLTILNPEGRIWTLVAGGGASV
VYADTIADLAGGVSELANYGEYSGGPTTDETRFYTETVLDLMTRQKDPKGRDKILIIGGA
IANFTDVAKTFTGIIQAFEKYADKMKDVGVRIYVRRGGPNYEKGLKDIKEAADKLGLPIK
VFGPETHITDIVRMAVEEDKAKA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagagcgatacgcgaatatgacggcaaaaaactttttgcccaaaactgggat
aaatattttaaaggtctgaagtatcctttcgaaagtgtactcgtaaccagtggagacgag
cttaagaaaaaagctgaagaacctggatatgaatggctcaaaaccaaacctcttgttgca
aaaccagatatgctttttggaaaacgaggaaaaaacaatcttgttctttttaaagtgaac
aaacctggtgatgtgacacttgaagatgccgcaaaatggatcgatgagaaaagaaatcaa
gaaactacacttttgagtggacaaaagggagtattgacccatttcattgtcgaacctttt
actccgcacagtgaagatgaagagtactacatcgctgcaacaactctagatgaaaactat
gatgtgctttacatgagtgctcatggtggtatggaagtagaagaaaactgggacaaagtc
acagaagtaaaaattcctattaacgcaagtgatgaagagattgaaaaactcataaaagag
aatattccagctgatattccagaggataaaaaagaggtatatgccaattttgcagtaaat
ttctataaatttttcagagaccttaactttgcatatcttgaaatcaacccagttgtcatt
gttggagacaacgtatatctccttgaccttgttgcaagacttgacgatacggcaggattt
ttgatgaaagatgtttggggtgatattgaattcccaacaccgtttggaatgccagaaaag
agtccagaggaaaaagctattgcagaagcagatgctaaaagtggcgcttctttgaaactt
acaatactcaatccagaaggaagaatctggactctggttgctggtggtggtgcttctgtt
gtgtatgcagatacgattgccgatttagctggaggtgtttccgagcttgccaactatgga
gaatattctggtggtcctacaacagatgagacacgattttatacagaaactgttcttgat
cttatgactcgccaaaaagacccgaaaggaagggataagatcttgattatcggtggcgcg
attgcaaactttacagatgttgcaaaaacatttacaggaattatccaggcttttgaaaaa
tatgcagataagatgaaagatgtaggtgtgagaatctatgtacgacggggtggtccaaac
tatgaaaaaggactaaaagatattaaagaagcagctgacaaactcggacttcctatcaaa
gttttcggaccagaaacacatattaccgatattgtacgaatggcagtagaagaagataaa
gcaaaagcataa

DBGET integrated database retrieval system