KEGG   Nitratiruptor sp. SB155-2: NIS_0706Help
Entry
NIS_0706          CDS       T00565                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00260  Glycine, serine and threonine metabolism
nis00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01130  Biosynthesis of antibiotics
nis01230  Biosynthesis of amino acids
Module
nis_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIS_0706 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NIS_0706 (trpB)
Enzymes [BR:nis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NIS_0706 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAF69820
UniProt: A6Q2W1
Position
complement(713296..714495)
Genome map
AA seq 399 aa AA seqDB search
MYIPKPSKFDPDEFGHFGIHGGRYVPETLMPILLELEEEYKKLRFDEEFWKEARYYLENY
VGRPSPLYYAQNISKELGATVYLKREDLNHTGAHKINNTILQGLVAKKLGKKKVIAETGA
GQHGVATATMAALFGLECEIFMGEKDVKRQELNVFRMKLLGAKVHSVKNGSRTLKDAMNE
AIRHWVSNARDTFYVIGTVAGPHPYPMIVRDFQGIIGYEAKAQILTAEKRLPDYVIACIG
GGSNAMGIFNAFLDEEETQCIGIEAGGLGLDTDKHGASLAKGSPGVLHGQMSYVLQDEEG
QILEAHSISAGLDYPGIGPEHSFLKDEGVVQYDAITDQEALDAFVWLSQKEGIIPAFESS
HAVAYLKKMNDIQNSLVIVNLSGRGDKDMIQAKSLLHFD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtacattccaaaaccaagcaaatttgacccggacgaatttggacattttggtattcat
ggagggcgttatgtcccggaaaccttgatgcctattcttttggaactggaagaagagtat
aagaaactacgctttgacgaagagttttggaaagaagcgagatactatcttgaaaactat
gtgggacgccccagtccactctactatgcacaaaatatctcaaaagagcttggagccact
gtctatctcaagagagaggacctcaaccatacgggtgcccataagatcaacaacacaata
ttgcaagggcttgtcgccaaaaaacttggcaagaaaaaggtgattgcagaaacaggtgca
ggacagcatggtgtggctactgctacaatggcggccctttttggactcgaatgtgaaatc
tttatgggcgaaaaagatgtaaagagacaagaactcaacgtttttcggatgaaactgctt
ggtgcgaaggtacactcagtcaagaacggctctcgaacattgaaagacgcaatgaatgaa
gcgattcgtcactgggtcagcaatgccagagacaccttctacgtcatcggtacagtcgct
ggacctcatccgtatcctatgattgttcgagatttccaaggaatcatcggttacgaagca
aaagcacaaatattaacggctgaaaaaaggcttccagattacgtaatcgcttgtatagga
ggtggaagcaacgcaatgggcatattcaacgcctttttggatgaagaagaaacccagtgc
atcggtatcgaagctggaggtcttggacttgacaccgacaaacatggagcaagccttgcc
aaagggagtcctggagtgctccatggccagatgagctatgtgctccaagatgaagagggt
cagattttagaggcgcactccataagtgcgggtcttgattatccagggattgggcctgaa
cactcctttttgaaagatgaaggggttgtgcagtatgatgccataaccgatcaagaggct
ttggatgcttttgtgtggctcagccagaaagagggaatcattccggcttttgaaagttcc
catgcggtagcctatcttaaaaaaatgaacgatatccaaaatagcctcgttatcgtcaac
ctctctggtcgaggggataaagatatgattcaggcaaaatctctactccatttcgattag

DBGET integrated database retrieval system