KEGG   Nitratiruptor sp. SB155-2: NIS_0897Help
Entry
NIS_0897          CDS       T00565                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIS_0897 (pfkA)
   01230 Biosynthesis of amino acids
    NIS_0897 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_0897 (pfkA)
   00030 Pentose phosphate pathway
    NIS_0897 (pfkA)
   00051 Fructose and mannose metabolism
    NIS_0897 (pfkA)
   00052 Galactose metabolism
    NIS_0897 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    NIS_0897 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NIS_0897 (pfkA)
Enzymes [BR:nis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NIS_0897 (pfkA)
Protein phosphatases and associated proteins [BR:nis01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NIS_0897 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
902661..903614
Genome map
AA seq 317 aa AA seqDB search
MKIAIMGSGGDAPGMNPAIKRFVEVAYEMGHEPYFIFDGLEGFIDGKIKKAYYEDVAGII
HRGGAIIGSSRSKRWYEKEYRKKAYENLKEYGIDAIIVMGGDGSFRALEVFKNEFSINFA
GIPTTIDNDIFGTDLCLGVDTAFNVIRDAIDKIRDTASTFARAFVIETMGRECGYLAAVS
AITSGAEVCVIPEVDFNKPLATKILKKELKEGRRYILSIVAEGTKRTSEIAQWLENDIGM
ETRVTILGHIQRGGNPTVQDRLLGFGFTLKALETLNAGDEGKIVVYRDGEFGVESLEDAL
KPYTIDPQILSMLHFLD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcgataatgggaagtggtggtgatgctcctgggatgaatcccgcgataaaa
aggttcgtggaagttgcatatgaaatgggacatgagccctattttatttttgatggtctt
gaaggattcatcgatggaaagataaaaaaagcttactatgaagatgttgcaggtattatc
catagaggaggggcaattattggatcttcgagatccaaaagatggtatgaaaaagagtac
aggaaaaaagcgtacgaaaatctcaaagagtatggtatcgatgcaatcattgtgatggga
ggagatgggagttttcgagctttagaggtttttaaaaatgaattttctatcaattttgca
ggcattccaaccactatagacaatgatatatttggaacggatctgtgtcttggagttgat
accgcttttaatgtcatacgagacgcgatcgataagattagagacacagcttccactttt
gcccgagcttttgttattgaaacgatgggcagagagtgtggataccttgcagccgtgagt
gccattacaagtggagcggaggtatgcgttataccagaagttgatttcaataaacctctt
gcaacgaaaatcttaaaaaaagagctcaaagagggaagacgatatatactttctatagtt
gcagaaggaacgaaaagaacatccgaaatcgcacaatggctggaaaacgatataggtatg
gagacaagagttaccattttgggtcatatccaacgaggcggtaatccgactgtacaggat
agattgctgggttttggttttactttaaaagcgctggagacattgaatgcaggtgatgaa
ggaaaaattgtggtatatagagatggagaatttggagttgagagtttagaagatgctctc
aaaccttatacgatcgatccacaaattctttctatgcttcattttctggattga

DBGET integrated database retrieval system