KEGG   Nitratiruptor sp. SB155-2: NIS_0920Help
Entry
NIS_0920          CDS       T00565                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00010  Glycolysis / Gluconeogenesis
nis00260  Glycine, serine and threonine metabolism
nis00680  Methane metabolism
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01120  Microbial metabolism in diverse environments
nis01130  Biosynthesis of antibiotics
nis01200  Carbon metabolism
nis01230  Biosynthesis of amino acids
Module
nis_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nis_M00002  Glycolysis, core module involving three-carbon compounds
nis_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_0920 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    NIS_0920 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIS_0920 (gpmA)
Enzymes [BR:nis01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NIS_0920 (gpmA)
Membrane trafficking [BR:nis04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NIS_0920 (gpmA)
Exosome [BR:nis04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NIS_0920 (gpmA)
  Exosomal proteins of melanoma cells
   NIS_0920 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAF70031
UniProt: A6Q3H2
Position
complement(929397..930089)
Genome map
AA seq 230 aa AA seqDB search
MKLVLIRHGQSVWNAKNLFTGWIDVELSEKGKAEAKKAGELLKEANIYPNICYTSYLKRA
IHTAQIALNELGWEHIDVIRSWKLNERHYGDWQGKNKEEVKAKYGEELFMAVRRGYDTPP
PPIEESEPDYAKRYPLDPKYEDIGYHPKSESLKDTRERVVEYFYEEIVPALLAYDTVMIA
AHGNSLRALIMYLESIAPENVSKIEIPTGTPIVYDLTKELVIYNKTTYNH
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggttcttatacgacacggacaaagcgtttggaatgcaaaaaatctttttaca
ggatggatcgatgtagagctcagtgaaaaaggaaaagctgaagcgaaaaaagccggtgaa
ctactcaaagaagcaaacatttatccaaatatatgttatacctcctatctcaaacgtgca
atccatactgctcaaatcgctctgaatgaacttggatgggagcatatcgatgttatccga
agctggaagttgaatgaacgccattatggtgactggcaagggaaaaacaaagaggaagtg
aaagctaaatatggtgaagaactgttcatggctgtcaggcggggatatgatacacctcct
cctccgatcgaagagagtgagcccgattacgccaaacgctatcccctcgatccaaaatat
gaagatattggataccatcctaagagcgaatctttgaaagatacgagagaaagagtagta
gaatatttttatgaagagattgttccggcactactggcatatgacaccgttatgattgcg
gctcatggaaactctttaagagctcttataatgtatcttgaaagcatcgcaccagagaat
gtaagtaaaatagagatcccaacggggacacctatcgtttatgatttgacaaaagaactg
gtaatttacaacaaaactacttacaatcattaa

DBGET integrated database retrieval system