KEGG   Nitratiruptor sp. SB155-2: NIS_0989Help
Entry
NIS_0989          CDS       T00565                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01130  Biosynthesis of antibiotics
nis01230  Biosynthesis of amino acids
Module
nis_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NIS_0989
Enzymes [BR:nis01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NIS_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE QRPTase_C TMP-TENI YmdB
Motif
Other DBs
NCBI-ProteinID: BAF70099
UniProt: A6Q3P0
Position
complement(1006167..1006955)
Genome map
AA seq 262 aa AA seqDB search
MILDEIIKKTKADLEKRKKEYPLEWLGRSLAYNPFVPRPVEEVLKSTPDDPYKIIAEVKK
ASPSKGVIREDFDPVAIAKEYEKGGANAISVLTEPHYFQGHIEYLTQIRRYVPMPLLRKD
FIIDKYQLVEALVYGADFVLLIAKALSRKELKELLEYTWHLGMEALVEIHDKADLIKAIF
AGANIIGINHRNLETFEMDMSLSEKLIPLIPNGKIIVAESGIHSHEQVVELNKLGVDAFL
IGEHFMRQDNIAEVVKKIKGLA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgattttggacgaaattattaaaaaaacgaaagccgatcttgaaaaacgaaagaaagaa
tatcctttggagtggcttggtagaagtcttgcatacaatccgtttgtcccgcgacctgta
gaagaggtactaaaaagtacgccagacgatccgtataagatcattgcagaagtgaaaaaa
gccagtcccagtaaaggagtaatacgagaggatttcgatcctgtcgctatagccaaggag
tatgaaaagggtggggcgaatgcgatttctgtgttaactgaaccacactactttcaagga
cacatcgaataccttacacagattagacgctatgtacccatgccgcttcttcgaaaagat
ttcatcatcgacaagtatcagttggtggaagcgttggtatatggagccgattttgttttg
ttgatagcaaaagcgttaagtagaaaagagcttaaagagcttcttgaatatacctggcat
cttggtatggaggcacttgtcgagattcatgacaaagccgatttgatcaaagcgattttt
gcaggggccaatatcataggtatcaatcataggaatctagaaacatttgagatggatatg
agtttgagtgaaaagcttattcctctaataccaaatgggaaaataatcgttgctgaaagc
ggcattcattcccatgaacaggttgtggaattaaataagttaggagtggatgcattcttg
atcggtgagcatttcatgcgccaagataacattgctgaagtagtcaaaaagatcaaaggc
ttagcctaa

DBGET integrated database retrieval system