KEGG   Nitratiruptor sp. SB155-2: NIS_1013Help
Entry
NIS_1013          CDS       T00565                                 

Gene name
valS
Definition
valyl-tRNA synthetase (EC:6.1.1.9)
Orthology
K01873  
valyl-tRNA synthetase [EC:6.1.1.9]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:nis00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    NIS_1013 (valS)
Enzymes [BR:nis01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     NIS_1013 (valS)
Amino acid related enzymes [BR:nis01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NIS_1013 (valS)
Transfer RNA biogenesis [BR:nis03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    NIS_1013 (valS)
 Prokaryotic Type
    NIS_1013 (valS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027832..1030447
Genome map
AA seq 871 aa AA seqDB search
MSKATKYDPKKVERQFYQIWETRGYFETDGNKKIQNGKTFCIMMPPPNVTGRLHIGHALT
FTLQDIMVRYKRMDGYETLWQPGTDHAGIATQNVVEKQLLSKGIKKEEIGREKFLEYVWK
WKEESGNAIVTQLRLLGVSPAWSRERFTMDKGLKNAVREAFVNLYYEGLIVKGNYMINWC
THDGALSDIEVEYEEKEGALYHIKYPIVGSDEYLVVATTRPETYFGDTAVMVNPNDERYK
HLIGKKVRLPLINREIPIIADEHVDMEFGTGAVKVTPAHDPNDYEVGKRHNLPFITIFDE
NGILNEEAGEFAGIERLEARKKVVEKLEQEGFIEKIEPHKHQVGHCYRCGNVVEPYISPQ
WFVKAEIAKEAVKKANEGETKFYPPQWLNNFNAWMRELRDWCISRQLWWGHRIPVWYCRA
CGHEWASKKEHEESCPKCGSTDIYQDPDVLDTWFSSALWPFSTLGWGNGDWGKGVKWFED
DLKKFYPNDLLITGFDILFFWVARMMMMGEHFLHKLPFKDVYLHALVRDEHGQKMSKSRG
NVIDPIDTIEEYSADALRFTLAALAVQGRDIRLSKERLELYRNFTNKLYNAARFLQIHQE
KFDDLQNIQIKTDLGKYILSRFGLAIQEVRNNLNSYRFNDAATTLYRFLWGEFCDWGIEL
SKVNKDAIAELGAIFKESMKLLHPFMPFITEFLYQELSGTSIEENESIMIQPYPKAAPID
EEIMKRFETIIDAIVSIRRAKALIDMANKTIPKVLIKGDLEESAKAYISKLAKVETIEFV
SEPAENAVTDIGNYVEVFIPLEGIDLTPILNRLNKQKEKLQKEIDKLSRMLSNENFVKNA
PQAVVEQNRAALAEAQNRLATIEEELARLTR
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagcaaccaaatatgatcccaaaaaagtagagaggcaattttatcaaatttgg
gaaacgagaggctatttcgaaacagatggaaacaaaaagatacaaaacggcaagactttt
tgtatcatgatgccccctccaaatgtaacgggacgtcttcacattggacatgcccttacc
tttaccctccaagatatcatggttcgctataagcgaatggatggatatgaaacgctttgg
cagccaggaacagaccatgcaggtatcgctacacaaaatgtagttgaaaagcagcttttg
tccaagggtatcaaaaaagaagagatcgggcgagaaaaatttttggaatatgtatggaaa
tggaaagaggagtctggtaacgctatagtaacccagcttcggcttttgggtgtctctcct
gcatggagcagagaacgctttaccatggataaagggctcaaaaatgcagtacgggaagcc
tttgtaaacttgtactatgaagggctcattgtcaagggcaactatatgatcaactggtgt
acccatgatggggcattgagcgatatcgaagtggagtatgaagagaaagagggagcttta
taccacatcaaatatcctatcgtaggaagtgacgaatatctcgtcgttgccacaacacga
ccggaaacctattttggcgatactgctgttatggtcaatccgaatgatgagcgctataag
catttaataggcaaaaaagtccgactcccacttatcaatagagaaattcctatcattgcc
gatgaacatgtagatatggaatttggaactggtgcggtgaaagtaactcccgcacacgat
ccaaacgactatgaggttggaaaacggcacaatctccctttcattactatattcgacgaa
aacggaatcttaaacgaagaagctggcgagtttgctggaatcgaacgattggaagcgaga
aaaaaagttgtcgagaaattggaacaagaagggttcatagaaaaaatagaacctcacaaa
catcaagttggacactgctatcgatgtggtaatgtggttgaaccatacatttctccacaa
tggtttgtgaaagctgaaattgccaaagaggctgtaaaaaaagcaaacgaaggagagaca
aaattctaccctccccaatggctcaacaactttaatgcctggatgcgtgaattgagagac
tggtgtattagcaggcagctttggtggggacacagaattcctgtctggtactgtcgggct
tgtggacatgagtgggctagcaaaaaagagcatgaagagagctgtccaaaatgtggcagc
accgatatctatcaagatccggatgttcttgatacctggtttagttcagctctttggcca
ttttcaactcttggatggggcaatggcgattggggcaaaggtgtaaaatggtttgaagat
gacttaaaaaaattctacccaaacgatctgctcatcacaggatttgatatcctctttttc
tgggtagcacgaatgatgatgatgggtgaacactttttacataaactcccattcaaagat
gtctatcttcacgcactcgttcgagatgaacatggtcaaaagatgagtaaatcaagaggc
aatgtgatcgatccgatcgatacgattgaagagtacagtgccgatgctttgaggtttact
ctagcagcgcttgctgtacagggaagagatatacgcctttcaaaagagagattggagctt
tatagaaactttaccaacaagctctacaatgcagccagatttttacagatacaccaagaa
aaatttgatgatctgcaaaatatccaaatcaaaacggaccttggaaaatatatactcagc
agattcggcttagcaattcaagaagtaagaaacaatctcaatagctatcgattcaatgat
gcggcaacgacactctatcgatttttatggggagagttttgtgactggggtattgagctg
agtaaagtaaataaagatgcaatcgctgaacttggagcgatttttaaagaatctatgaaa
ctgctccatccttttatgccatttatcactgagtttctctatcaagaactgagtggcaca
agtatagaagagaacgaatctataatgattcaaccttatccaaaagcagcacctatcgat
gaagagataatgaaacgctttgaaacaattatcgatgcaatcgtttccatcaggcgcgca
aaagctcttatcgatatggccaacaaaacgattccaaaggtattgattaaaggcgatctg
gaagaatccgcaaaagcatacatctctaaacttgccaaagtggaaacgatcgaatttgtg
agtgaacctgcagaaaatgccgtgaccgatattggtaactatgtggaagttttcattccg
cttgaaggtatcgatcttactccaatcctcaatagactcaataaacaaaaagagaaacta
caaaaagagatagataaactgagcagaatgctctccaatgaaaactttgtaaaaaacgct
ccacaagctgtggttgaacaaaatcgagccgcactagcagaagcccaaaacagacttgct
acaattgaagaggaattggcgagactcactcgctaa

DBGET integrated database retrieval system