KEGG   Nitratiruptor sp. SB155-2: NIS_1076Help
Entry
NIS_1076          CDS       T00565                                 

Definition
two-component sensor histidine kinase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:nis02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:nis02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1090738..1094340)
Genome map
AA seq 1200 aa AA seqDB search
MKIVALGASAGGYEALQEFIKNLDEEYSKDIAFVITQHLDPTHPTLLKDLLSRYTTLPIK
MIYDHQKIGPGTIYICPPNNNLTVNEQQEFILTPPGEKGFPKPSINLFLKSLAKHFDGDI
VAIILSGTGSDGAEGIVAVKNAGGITIAQDPKEAKYSSMPQAAIQTGCVDLVLPVKDIAK
NLLKILNIPHTVEKGTEKSSLETIFDMLQEKFNVDFTDYKIGTIHRRIERRMAVNNVNSL
QEYIEILRNNPQELKLLFKDLIIIVTSFFRDKEFWGILEKHIVNQMSESQDEDYRVWVPG
CATGEEAYSIAMLLDKICHQMKIHKKITIFATDISEEAIRKARIGIFSKDEVENIDDFYL
ENYFRKIDNDKYEIIKEIREKIIFSVHDLIKDSPFLNLDLISCRNLLIYFNPILQNRIIN
IFHHSLKDNGILFLGKSEAISSLNEKFIVLDAKARIFKKDPTYKQTDLSALTYYPKRYKN
KIALLASDHSEQKLESALTKEETLLKSVVQALMKNIFKNIVIINRNNNIVYVGGNASKYL
QFPKGNFSNDILTLINNELKFDVRYLISKVRTEAISINKRIRYTEDENKTKVQYINIMAI
PFSNQHCRDCIALIFIESSDEVAIDKDIKIDNKDLQQYINDLETELMLTKEQLQTTIEEL
ETSNEELQSANEELQSANEELQSTNDELETSNEELQSTNEELRTVNEELEIKTQKLREKT
NDLENIFRILDFGAVIVDNELRIKNFTQKANYIFNLSYENLHELITTVGTKVDISNIRPI
LERVIKTKKEYSFEVKDKHKIFQIKIVPYIDKNSIHKECKGAIIAIYDVTEYRKKEEMLQ
NYQKKLLLEQEKLKTIIDESQNIILLANRSHIFLANKKFFTFLGIRNLEQLKEKMVYEFF
EEDSPLFQKVKKEKWMEYLKKHPEEAHEVYLKDKNGNKRIFLIKVSQTSIDKKRIVTLTD
VTEMKRKDLLLIQQSKLAAMGEMIANIAHQWRQPLNLLSLLITNLQVSFQNNHLTEDKFE
EFYEKSNEIIQNMSKTIDDFRNFFSTHKVKVKFRLKELIEDTKKIVLPALEQNHITLKED
IKDIELFGYKNELMQVLINVINNAKDAIKERKIQYGQIILSNKIERKYVYFYVQDNGGGI
EPEILDKVFEPYFTTKFKSHGTGLGLYMSKMIMEAMGGDIILENEGDGVKVTLKIPKETQ
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagtggctttaggagcaagtgcaggaggatatgaagcactacaagagtttata
aaaaatttagatgaggaatatagtaaagatattgcttttgttataacacaacatctcgat
ccaacccatccaacccttctaaaagatttgctttcaaggtataccactttaccgattaag
atgatttatgatcatcaaaagattggacccggaactatttatatctgtccaccaaacaat
aatttaacagtcaacgaacaacaagagtttattctgacacctccaggagaaaagggattt
ccaaagccttctatcaatctttttctcaaatcgcttgcaaaacattttgatggggatatc
gttgcgattattctttctgggaccgggagtgatggagcagagggaattgtagctgttaaa
aatgctggaggtattaccatcgcacaagatcccaaagaggcaaaatactcctccatgccg
caagccgcaattcaaactggatgtgttgatttagtgcttccagtcaaagatattgccaaa
aatctactaaaaatcttaaatattccccataccgttgaaaagggaacggaaaaaagcagt
cttgaaaccatttttgatatgttacaagaaaaattcaatgtcgattttacagactataag
attggaacgattcatcgaagaattgaaagaagaatggctgtaaataatgtcaattcactc
caagagtatattgagattttacgtaacaatccacaggaacttaaactattatttaaagat
ttgatcattattgtaacctctttttttcgggataaagagttttggggaatacttgaaaag
catattgttaatcagatgagtgaaagtcaagatgaagattatagagtctgggttcctgga
tgtgctacgggagaagaagcttattcaattgcaatgcttttggataagatttgccaccaa
atgaagattcataaaaaaataacaatctttgcgacagatattagtgaagaggctataaga
aaagcacgaatcggaatattctctaaagatgaagtggaaaatattgatgatttttatctt
gaaaactattttagaaaaattgataacgataaatatgagataatcaaagagattcgggaa
aaaataattttttctgttcacgatctcataaaagattctccatttttaaatctcgatcta
atcagttgtagaaatcttttaatttattttaatccaatattgcaaaatagaattatcaat
atttttcatcactctttaaaagataatggaatcttatttttaggtaagagcgaagcaatt
tcgagcttgaatgagaagttcatcgttttagatgcaaaagctagaatctttaaaaaagat
cccacatacaaacaaaccgatttaagtgcattgacttactatccaaaaagatataaaaat
aaaattgctttattggcttcagatcatagtgaacaaaaactggaaagtgctcttacgaaa
gaagaaactcttttaaaaagtgtagtccaagcgttaatgaaaaatatttttaaaaatatt
gtcattatcaatcgaaataacaatattgtttacgttggaggtaatgcaagtaagtattta
caatttcctaagggcaattttagtaacgatattttgacacttattaacaatgaattgaaa
tttgatgtgagatatttgatttcgaaagtaagaacagaggcaatttcaattaataaaaga
attcgttatacagaagatgaaaacaaaacaaaagtacaatatattaacatcatggcgata
cctttcagtaatcaacactgcagagattgcattgctttaatctttatagaaagttccgat
gaagttgcgattgataaagatatcaaaatagacaacaaagatttacagcaatatatcaat
gatcttgaaacggaattgatgcttacaaaagaacaacttcaaacaacgattgaagagctt
gaaacttccaacgaggaactccaatcagccaatgaggagttgcaatcagccaatgaggaa
ctgcaatcaacaaatgatgagcttgaaacttccaatgaagagctacaatcaaccaatgaa
gagttacggacagtcaacgaagagttagaaattaaaacacaaaagttaagggaaaaaaca
aacgatttggaaaatatttttaggattttagattttggagccgttattgtcgataatgag
cttcgtatcaaaaactttacccaaaaagcaaactatatttttaatctatcctatgagaat
cttcatgaattgattactacagttggtacgaaagttgatataagcaacattcgaccaatt
ttggagcgtgttattaaaacaaaaaaagagtatagttttgaagtcaaagacaaacataaa
attttccagatcaaaattgttccttatatcgataaaaattctatccataaagagtgcaaa
ggtgctattatcgcaatctatgatgtaactgagtatcgaaaaaaagaagagatgctccaa
aattatcaaaagaaattattgttagagcaagaaaaactcaaaacgattatcgatgaatcg
caaaatattattttacttgctaatagatcccatatctttttagcaaataagaaatttttt
acctttttaggtattaggaatttagagcaacttaaagagaaaatggtttatgagtttttt
gaagaagattctccactttttcaaaaagtcaaaaaagaaaaatggatggagtatctcaaa
aaacatccagaagaagcgcatgaggtctatttgaaagacaaaaatggcaataaaagaata
tttttgatcaaagtcagtcaaacatcaatcgataaaaagcgtattgtaacacttacagat
gtgacagagatgaaacgaaaggatcttttacttatccagcaatccaaattagcggccatg
ggagagatgatagcaaatattgcccatcaatggagacaacctctcaatcttttgagtcta
cttattaccaatttacaggtatcatttcaaaataatcatttaacagaagataaatttgaa
gagttttatgaaaaaagcaatgaaatcattcaaaatatgtcaaaaacgattgatgatttt
agaaactttttttctacccataaggtaaaggtgaaattcagactcaaagaacttattgaa
gatacaaaaaagattgttttaccggctttagagcaaaaccatattaccctaaaagaagat
atcaaagacatagaactctttggctataaaaatgaattgatgcaggtgttaatcaatgtg
attaataacgcaaaagatgctataaaagagcgaaaaattcaatatggacagattatactt
tccaacaaaattgaaagaaaatatgtctatttttatgtccaagacaatggtggaggtatt
gagccagaaattttggacaaagtgtttgaaccatactttacaacaaaatttaaatcacat
ggaacagggctggggctgtatatgtccaagatgattatggaagcaatgggtggcgatatt
atattggaaaatgagggtgatggcgtgaaagtaactcttaaaattccaaaggaaacacaa
tga

DBGET integrated database retrieval system