KEGG   Nitratiruptor sp. SB155-2: NIS_1237Help
Entry
NIS_1237          CDS       T00565                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00300  Lysine biosynthesis
nis01100  Metabolic pathways
nis01120  Microbial metabolism in diverse environments
nis01230  Biosynthesis of amino acids
Module
nis_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NIS_1237 (dapE)
Enzymes [BR:nis01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NIS_1237 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18 Peptidase_M42 DUF1344
Motif
Other DBs
NCBI-ProteinID: BAF70346
UniProt: A6Q4D7
Position
complement(1255959..1257053)
Genome map
AA seq 364 aa AA seqDB search
MEVIDLFKKLLSFPSITPDDAGSLEFIREYLSDFHALWFNKHGVKNLFLYKKFGEGEHLC
FAGHVDVVPPGDGWESDPFEPLEKDGFIYARGAQDMKSGVAAFVQAVKEAKVFHGTLSLL
LTSDEEGEAKWGTKYALEELERMHMTPQYAIVAEPTCEERFGDAIKIGRRGSINGVIEKI
GKQGHAAYPEKAVNPIHKVAQVLPKMAGVDLDSGDEYFAPSKFVITDIRAGMEVTNVTPG
RLKMMFNVRNNTKTTMQDVERFVHRYFDGMNYTLKLSQSAKPFLTDPNSKVVQVIDQAIK
KMTGITPKHSTAGGTSDARFFAEYGVKTIEFGVKNDTIHAPNERTSKEEVEKLYLVFKEV
IRSF
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcatcgatctgtttaagaaactgctctcttttcccagtatcactcctgatgat
gcggggagtttggagtttatcagggagtatctctcagactttcacgctctgtggttcaat
aaacatggcgtgaaaaatctctttctgtacaaaaagtttggcgaaggggagcatctatgc
tttgcaggccatgtggatgtggttccgccgggagatggatgggagagtgatccatttgaa
cctttggaaaaagatggttttatctatgcacgaggcgcgcaggatatgaaaagtggtgtt
gccgcttttgtgcaggcggtcaaagaggcaaaagtgttccatggaactctttcgttgctt
cttacaagcgatgaagagggtgaggcgaagtggggcacgaaatatgctttggaagaactc
gagcgaatgcatatgactcctcagtatgccatcgttgctgagccaacatgcgaagagcgc
tttggcgatgcgataaagattggccgaagaggttcgataaacggcgtgatagaaaagatt
ggcaaacaaggacatgcagcgtaccctgaaaaagctgtcaaccctatccacaaagtggct
caagttttaccaaaaatggcaggagtcgatcttgacagtggcgatgagtattttgcgccg
agcaagtttgtcattaccgatatcagggcagggatggaagtgacaaacgtgacgcccggc
agactgaagatgatgttcaatgtccggaacaatacaaaaacgactatgcaggacgtggaa
cgttttgtgcatcgatattttgatgggatgaactatacactgaaactgagtcaaagtgca
aaaccgtttttaaccgatcctaactcgaaagtggtacaggtgatcgatcaagcgatcaaa
aaaatgacaggaattacacccaaacactctaccgccggtgggacaagtgatgcacgattt
tttgctgaatatggcgtaaaaacgatagagtttggtgtgaaaaacgatacgattcatgcg
ccaaatgagagaacatcaaaagaggaagtggaaaaactgtaccttgtttttaaagaggtg
atacgaagtttttaa

DBGET integrated database retrieval system