KEGG   Nitratiruptor sp. SB155-2: NIS_1412Help
Entry
NIS_1412          CDS       T00565                                 

Gene name
hisH
Definition
imidazole glycerol phosphate synthase subunit HisH (EC:2.4.2.-)
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nis01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:nis00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1434182..1434796)
Genome map
AA seq 204 aa AA seqDB search
MKIAIIDYNMGNLRSVSNAFEKIGYPAIIEKDPDKLKNYDKVILPGVGAFGDAMEHLEGS
GLKEAILDFAKSGRNMLGICLGMQLLFNKSYEFGEHEGLGLIEGEVIPFDRSRFDQRLKV
PHMGWNELFVQKETPLFSGLPKAFYLYFVHSYHAVCDEKYVIGKTLYGYEFVSAVQNGNV
FGLQPHPEKSHENGLKILKNFVEL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagcgatcattgattacaatatggggaatcttcgaagcgtgtcgaacgctttt
gaaaagatcggttatccggccatcatcgaaaaagatcctgacaaacttaaaaactatgac
aaagtgattcttccaggagtcggtgcatttggagatgcgatggagcatcttgaaggaagt
ggactcaaagaggcgatcctcgactttgccaaaagtggccggaatatgctaggcatctgt
cttggaatgcaactgttgtttaacaaaagttacgagtttggagagcatgaaggcctggga
ttgattgaaggtgaagtcattccttttgataggagccgttttgatcaaaggctgaaagtc
cctcatatgggctggaatgagctttttgtgcaaaaagagaccccacttttttcggggctt
ccaaaggccttttatctctattttgttcatagttaccatgccgtttgcgatgaaaaatat
gtgataggaaaaacactctatggatatgagtttgtcagtgccgttcaaaatggcaacgtt
tttggccttcagccccatcccgaaaaatcgcacgagaacggcttgaaaatcttgaaaaat
tttgtggagttgtag

DBGET integrated database retrieval system