KEGG   Nitratiruptor sp. SB155-2: NIS_1428Help
Entry
NIS_1428          CDS       T00565                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00010  Glycolysis / Gluconeogenesis
nis00030  Pentose phosphate pathway
nis00051  Fructose and mannose metabolism
nis00052  Galactose metabolism
nis00230  Purine metabolism
nis00500  Starch and sucrose metabolism
nis00520  Amino sugar and nucleotide sugar metabolism
nis00521  Streptomycin biosynthesis
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01120  Microbial metabolism in diverse environments
nis01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_1428
   00030 Pentose phosphate pathway
    NIS_1428
   00051 Fructose and mannose metabolism
    NIS_1428
   00052 Galactose metabolism
    NIS_1428
   00500 Starch and sucrose metabolism
    NIS_1428
   00520 Amino sugar and nucleotide sugar metabolism
    NIS_1428
  Nucleotide metabolism
   00230 Purine metabolism
    NIS_1428
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NIS_1428
Enzymes [BR:nis01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NIS_1428
    5.4.2.8  phosphomannomutase
     NIS_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: BAF70535
UniProt: A6Q4X6
Position
complement(1447120..1448493)
Genome map
AA seq 457 aa AA seqDB search
MESIFREYDIRGIFQKELNVDIVKKIGYFLAQEVNGEYIAVGYDARLSSPTLFSWLTSGI
NKAGKKVLGMGMVPTGVNYFSNFVSFEIAGRKVVPSASVMITGSHNPPEYNGFKITVEKK
PFFAKQIKKLGQKVLSSDISIEDNDTFYAIPAKERYVDFMLKEFAHLKGFDQKIALDCGN
GVAGVVLEPLFQALEFDYFGLYCEPDGNFPNHHPDPSEERNLKDLKKALADADIGFAYDG
DADRIAVLTKKHNFKGDELAIIFARYMENPTVIGEVKCSQVMYDEINKRGRAIMYKTGHS
NLKEKIAEVDADFAAEVSGHLFFNDRYFGFDDAIYATFRVIELIHQGVDLDKEIERLPKV
YNTPEIKVQTTEECKFKIIDALKQVLQNPPHGFPTIKEIIDVDGLRIVFEEGWALVRASN
TTPVLVTRFEAVSEEKAKEYEGKVMELVEKIKDDLCK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgatctttagagaatacgatataagaggcattttccaaaaagagctcaatgtt
gatattgtcaaaaagataggctactttttggcacaagaggtgaatggagagtatatcgct
gttggatatgatgcaagactctcttcgccaacactcttttcctggctcaccagtggtatc
aataaggctggaaagaaagtgctgggcatgggtatggtgccaacgggcgtgaactatttt
agcaattttgtctcttttgaaatagctgggcgcaaagttgtgccatcggcttcagtaatg
atcaccggctctcacaatcctcctgaatataacggttttaaaataacggtagaaaaaaag
cccttttttgccaaacagatcaaaaagcttggccaaaaggtactaagcagcgatatttcg
atagaagacaacgatacattctatgccattcctgctaaagagcgatatgtcgattttatg
ctcaaagagttcgcacatctcaaaggatttgatcaaaaaatagctctagattgcggcaat
ggcgtggctggagttgttcttgagcctctttttcaagcgttggagtttgactatttcggg
ctctattgcgagccagacggcaattttccgaaccaccatccagatccgagtgaagagagg
aatttgaaagatctcaaaaaagctttggcagatgcagatatcggttttgcctatgacggg
gatgcagacagaatcgcggtactgaccaaaaagcacaatttcaaaggggacgagcttgct
atcatctttgccagatatatggaaaatccgacagttataggtgaagtgaaatgctctcaa
gtgatgtacgacgagattaacaaaagaggccgagccattatgtacaaaacgggtcatagc
aatctcaaagagaagattgccgaagttgatgccgattttgccgcggaagtgagtggtcat
ctcttttttaacgatcgatattttggatttgatgatgcgatctacgcaacgtttcgggtt
atcgagttgattcatcaaggagtcgatcttgataaggagattgagcgtttgccaaaggtg
tataatacccctgaaatcaaagtccaaaccacggaagagtgtaaatttaaaataatcgat
gcactgaagcaagttttgcaaaatcctcctcacggttttccgactatcaaagagatcatc
gatgtggatggactgcgcatcgtttttgaggagggatgggcacttgttcgagcgagcaac
acgacgccggttttggttactcgatttgaagcggtgagcgaggaaaaagccaaagagtat
gaaggaaaagtgatggaactggttgaaaagataaaggacgatctatgcaaataa

DBGET integrated database retrieval system