KEGG   Nitratiruptor sp. SB155-2: NIS_1475Help
Entry
NIS_1475          CDS       T00565                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:nis00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1501451..1502212
Genome map
AA seq 253 aa AA seqDB search
MKRKAPAKINIFLKIVGTRGKYHEIASRFIRYEKLFDEIAFVPSKQEEFTIEGMNIPLQS
NLIYKAYTKLKEFTQNGQLDAFFQSHKVVLNKNIPEGAGLGGGSSDAATFLLMTNEILSL
KIDQKDLMHVGATVGADVPFFISKLPAANVTGIGEVIEPLEDEIPEIELFTPSVHCDTAA
VYTHFRQNFLNTIQKEVAKKMLQKTSKEIVREYTPLQANDLYKSAVQICPVLQKYQEKYF
LSGSGSSLFREKQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaaagctccagcaaaaatcaatatttttttaaaaattgtcgggacaagaggc
aaatatcacgaaatcgcttcacggtttatccgatacgagaagcttttcgatgagatcgct
tttgttccaagcaaacaagaagagttcactatagaaggcatgaatattcctttgcaatcc
aatctcatctacaaagcctatacaaaacttaaagaattcacacaaaacggacaactggat
gcgtttttccaatcacataaagtggtcttgaacaaaaacatacctgagggggccggtcta
ggtggaggaagcagtgatgcggcaacctttttactcatgaccaatgagatactctcttta
aaaatcgatcaaaaagatttgatgcatgtaggtgcaactgtgggggcggatgttcctttt
ttcatttcaaaactgcctgcggcaaatgtaacgggaatcggagaagtaatcgaaccctta
gaagatgagattcctgaaatagaactttttacaccttctgtacactgtgacaccgctgca
gtctatacacattttcgacaaaactttttaaacaccatccaaaaagaggtagccaaaaaa
atgctacaaaaaacatccaaagagattgtacgagagtatacgccacttcaagcaaacgat
ctgtacaaaagtgcagtacaaatttgccctgtactgcaaaaatatcaagaaaaatatttt
cttagcggtagcggaagcagcctatttagggagaaacaatga

DBGET integrated database retrieval system