KEGG   Nitratiruptor sp. SB155-2: NIS_1477Help
Entry
NIS_1477          CDS       T00565                                 

Definition
signal transduction response regulator
Orthology
K13590  
diguanylate cyclase
Organism
nis  Nitratiruptor sp. SB155-2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1502672..1503724
Genome map
AA seq 350 aa AA seqDB search
MENQKRCQILGKIEQDIRLTKEDLKEIGFIVKKVVSFMVKNDILMTPENYARWFELFCYV
QENDLTLSDSEILQYYKQLFQKNPKKVHEIEDEEIHTKLKSIASSIEEKLSQIISTIDTH
NDTLQDKTEALQEKEHQAADPEILKYLKEILQNLEELRMENSQLNEQLKKYYEEINHLRR
ELRDTKNKAEFDYLTELFNRRKFEEYFHKLLKEFNEGEGKPFSLIILDIDDFKQINDTYG
HLLGDEVLKNLSSLIKTFLHSAHIPARIGGEEFAILLPETPLDEAKTIAERLRKTVENRT
IPIAEGDLNFTVSIGVAQVQKGDTMDSLLKRADEALYEAKRNGKNMVIAK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaaaaagatgccagattcttggaaaaatagagcaagatattcgattgaca
aaagaggatctcaaagagataggcttcattgtcaaaaaagttgtcagttttatggtcaaa
aacgatatcttgatgactccagaaaattatgcacgatggtttgaacttttttgctacgta
caagagaacgatctaacattgagcgatagcgaaatactccagtactataaacagcttttt
caaaaaaacccaaaaaaagtacatgaaatagaggatgaagagatccataccaaactcaaa
tccatagccagtagtatagaagagaagctctctcaaatcatctctaccatcgatacacat
aacgatacattacaagataaaacagaagcgttacaagaaaaagagcatcaagcagcagat
ccggaaattttaaaatatcttaaagagattcttcaaaacttggaagaattaagaatggaa
aactcccagctcaacgagcaactcaaaaaatattatgaagagatcaatcatctgcgaagg
gaactcagggatacgaaaaacaaagccgaatttgattatttgacagaacttttcaacagg
cgcaaatttgaagagtattttcataaactcctgaaagagttcaatgaaggagaagggaaa
cctttttctctcattattcttgatatcgacgatttcaagcaaatcaacgatacatatggc
catcttttgggggatgaagtactaaaaaatctctccagcctcatcaagacattcctccac
tctgcccatattcccgcacgtatcggtggagaagagttcgcgattttgcttccggaaact
cctttggatgaagcgaaaaccattgctgagcggctacgaaaaacggtagaaaacaggacc
atacccatagcagaaggggatctgaatttcaccgtaagtatcggcgttgcccaggtccaa
aaaggagatacgatggattcgttactcaaaagagcagatgaagcgttgtacgaggcaaaa
agaaatggaaagaatatggtgatagccaaatga

DBGET integrated database retrieval system