KEGG   Nitratiruptor sp. SB155-2: NIS_1490Help
Entry
NIS_1490          CDS       T00565                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIS_1490 (tpiA)
   01230 Biosynthesis of amino acids
    NIS_1490 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_1490 (tpiA)
   00051 Fructose and mannose metabolism
    NIS_1490 (tpiA)
   00562 Inositol phosphate metabolism
    NIS_1490 (tpiA)
Enzymes [BR:nis01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NIS_1490 (tpiA)
Exosome [BR:nis04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NIS_1490 (tpiA)
  Exosomal proteins of bladder cancer cells
   NIS_1490 (tpiA)
  Exosomal proteins of melanoma cells
   NIS_1490 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1514644..1515342)
Genome map
AA seq 232 aa AA seqDB search
MILAANFKMNHTRASTKAYIERLNAYGKQTDIDIAVFPPATALDQYETFADIGAQNAYAA
EHGSFTGEIGLQQLQEFGIETVLLGHSERRHIFYESQEMIARKFAFYKERGFTIYYCLGE
TLQTRKKGFEAIRELLQSQLEGIDTAYENFVIAYEPVWAIGTGVAAKPEEIEEVLAYLAS
LTDAPLLYGGSVKPANIKEVLSIPKCDGALIGTASWDVENFIKMIEIAKEMR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgcagcaaacttcaagatgaatcacactagagcttcgacgaaagcgtatatc
gagaggctcaatgcatatggaaagcaaacagatatcgatatagccgtatttcctcctgca
actgctcttgatcagtatgaaacgtttgcagatattggagcgcaaaatgcatacgctgcc
gaacacggctcttttacaggcgaaatagggttgcagcaacttcaagaatttggcattgaa
accgttcttctgggacatagtgagcgaagacatatattttacgaatcacaagagatgatt
gcaagaaagtttgcattctataaggaacggggttttacgatctactactgtcttggggag
acccttcaaacgagaaaaaaaggttttgaagcaattcgagagcttttacaaagtcagctt
gaaggtatcgatacagcttatgaaaatttcgttatcgcctatgaacctgtatgggctatc
ggtacgggagttgctgcaaaaccggaagagatagaagaggttttggcttatcttgcatca
ctgacagatgctccacttctatatggtggcagtgtgaaaccggcaaatatcaaagaggta
ctttccataccaaaatgtgatggagcgcttatcggcacggcaagttgggatgtagagaat
tttataaagatgatagaaatagcaaaggagatgagataa

DBGET integrated database retrieval system