KEGG   Nitratiruptor sp. SB155-2: NIS_1497Help
Entry
NIS_1497          CDS       T00565                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00230  Purine metabolism
nis01100  Metabolic pathways
Module
nis_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NIS_1497 (gmk)
Enzymes [BR:nis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NIS_1497 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin ABC_tran AAA_18 AAA_16 MMR_HSR1 AAA_17 RsgA_GTPase AAA_22 AAA_30 AAA_29 AAA_33 Thymidylate_kin AAA_21 Rad17 cobW AAA ATP_bind_1 ATPase_2 NTPase_1 dNK T2SSE MobB RNA_helicase AAA_28 AAA_14 NB-ARC AAA_25 Viral_helicase1 NACHT AAA_19 AAA_5 AAA_24 Cytidylate_kin TsaE
Motif
Other DBs
NCBI-ProteinID: BAF70604
UniProt: A6Q545
Position
complement(1520378..1521001)
Genome map
AA seq 207 aa AA seqDB search
MFQKGALLVISGPSGAGKSTLIKTIVEHIPDVYFSISTTTRPKRPGEVDGKDYYFVSKEE
FEKEIEAGMFLEWANVHGNYYGTSLRPVKQAVEEGKLVLFDIDVQGFDSIKKSQFSSLVT
SVFVTTPTMRELRIRLETRGTDDEETIQKRLQNALKEMEWMPQFDFILINEKLEQSKELI
LAIAKAARLRRDNEEIEAFIEQWRKTD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaaaggtgccttacttgtcatttcaggtccaagtggagcgggaaagagtacg
cttattaaaacgattgtagagcatattcctgatgtctattttagcatttctacgactacc
cgtccgaaacgtcccggtgaagttgatgggaaagattactatttcgtctcgaaagaggag
tttgaaaaagagatagaagccggaatgtttttggaatgggccaatgtacacggcaactac
tacggtacctctttgcgacctgtgaaacaggcggtagaagaggggaaacttgtccttttc
gatatcgatgtccagggattcgattctatcaaaaaaagccagttttcttctttggtgaca
tcggtgtttgtaacgacgccgacaatgagggagttgcgtattcgcctggagacccgaggg
acagatgatgaagagacgatacaaaaacggttgcaaaacgctctcaaagagatggagtgg
atgccacaatttgattttatcttgatcaatgaaaagttggaacaatccaaagagctaatt
ttggcaattgcaaaagcggctagactaagacgagataacgaagagatcgaggcttttatc
gagcagtggagaaaaactgattag

DBGET integrated database retrieval system