KEGG   Nitratiruptor sp. SB155-2: NIS_1602Help
Entry
NIS_1602          CDS       T00565                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00010  Glycolysis / Gluconeogenesis
nis00020  Citrate cycle (TCA cycle)
nis00620  Pyruvate metabolism
nis00633  Nitrotoluene degradation
nis00640  Propanoate metabolism
nis00650  Butanoate metabolism
nis00680  Methane metabolism
nis01100  Metabolic pathways
nis01120  Microbial metabolism in diverse environments
nis01130  Biosynthesis of antibiotics
nis01200  Carbon metabolism
Module
nis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_1602
   00020 Citrate cycle (TCA cycle)
    NIS_1602
   00620 Pyruvate metabolism
    NIS_1602
   00640 Propanoate metabolism
    NIS_1602
   00650 Butanoate metabolism
    NIS_1602
  Energy metabolism
   00680 Methane metabolism
    NIS_1602
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NIS_1602
Enzymes [BR:nis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NIS_1602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAF70708
UniProt: A6Q5E9
Position
complement(1615049..1616047)
Genome map
AA seq 332 aa AA seqDB search
MVKKIKNLKEFSLSNDRFEGANLMCPGCSHNIIVREVLNATDDPVIVATATGCLEVCTAV
YPKTSWDVSWIHIGFENAAVAAATVSAAYEVMKKKGKLPPATQKMVEEGREPKIVAFAGD
GGTYDIGFQSLSGAFERGHNFMYVCLDNEVYANTGGQRSSSTPIGASTTTSPAGSVSYGE
KMMKKSMVEIMADHGAPYVAQVSPSKWKDLVKKVQKGFEVYGPVYINAQSACTTEWKHAP
EDTIEVSDLGVDSCVWPLYEIINERDEHGIIYSTKLNITYRPKNKIPVEEYLAAQPRFRH
LFKPENRHIIDLWQKAVDARWEYLQRREEAGV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaagattaaaaacttaaaagagttttcactctcaaatgacaggtttgaaggt
gcaaacctgatgtgtccaggatgttcacataacattatcgttcgagaagttttgaatgca
acggatgatcctgtaatcgtagcgactgctaccggttgtttagaagtgtgtacggcagtc
tacccaaaaacgagttgggatgtgagctggatccatatcggatttgagaatgctgctgtc
gcagctgcaactgtcagtgcagcctatgaagtgatgaagaaaaaaggaaaactcccacca
gctacacagaaaatggttgaggaaggtagagagcctaaaatcgttgcatttgctggagac
ggtggaacatacgatatcggttttcagtctttaagtggagcttttgaacgaggtcacaac
tttatgtatgtctgtctcgataacgaagtgtatgcaaacactggaggacagagaagttct
tctacgccgatcggcgcaagtactacgacaagtccggccggaagtgtaagttatggtgag
aaaatgatgaaaaagagcatggtagaaatcatggcagaccatggtgcaccatatgttgcg
caggtgagtccaagcaaatggaaagatttggtcaagaaagtgcaaaaaggtttcgaggtg
tatggtcctgtttacattaacgcgcaaagtgcttgtacgacagagtggaaacatgctcca
gaagatacgatcgaagtgagtgatcttggcgtagacagctgtgtatggccattgtatgaa
atcatcaatgagcgtgacgagcatggaatcatctacagtactaaactcaacatcacatat
agaccaaaaaacaagataccggtagaggagtatcttgcagcacaaccaagatttcgacac
cttttcaaaccggaaaacagacacattatcgatctatggcaaaaagctgtggatgcgcga
tgggaatatctacaaagaagagaagaggcaggagtataa

DBGET integrated database retrieval system