KEGG   Nitratiruptor sp. SB155-2: NIS_1602Help
Entry
NIS_1602          CDS       T00565                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, beta subunit
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIS_1602
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_1602
   00020 Citrate cycle (TCA cycle)
    NIS_1602
   00620 Pyruvate metabolism
    NIS_1602
   00640 Propanoate metabolism
    NIS_1602
   00650 Butanoate metabolism
    NIS_1602
  Energy metabolism
   00680 Methane metabolism
    NIS_1602
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NIS_1602
Enzymes [BR:nis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NIS_1602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1615049..1616047)
Genome map
AA seq 332 aa AA seqDB search
MVKKIKNLKEFSLSNDRFEGANLMCPGCSHNIIVREVLNATDDPVIVATATGCLEVCTAV
YPKTSWDVSWIHIGFENAAVAAATVSAAYEVMKKKGKLPPATQKMVEEGREPKIVAFAGD
GGTYDIGFQSLSGAFERGHNFMYVCLDNEVYANTGGQRSSSTPIGASTTTSPAGSVSYGE
KMMKKSMVEIMADHGAPYVAQVSPSKWKDLVKKVQKGFEVYGPVYINAQSACTTEWKHAP
EDTIEVSDLGVDSCVWPLYEIINERDEHGIIYSTKLNITYRPKNKIPVEEYLAAQPRFRH
LFKPENRHIIDLWQKAVDARWEYLQRREEAGV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaagattaaaaacttaaaagagttttcactctcaaatgacaggtttgaaggt
gcaaacctgatgtgtccaggatgttcacataacattatcgttcgagaagttttgaatgca
acggatgatcctgtaatcgtagcgactgctaccggttgtttagaagtgtgtacggcagtc
tacccaaaaacgagttgggatgtgagctggatccatatcggatttgagaatgctgctgtc
gcagctgcaactgtcagtgcagcctatgaagtgatgaagaaaaaaggaaaactcccacca
gctacacagaaaatggttgaggaaggtagagagcctaaaatcgttgcatttgctggagac
ggtggaacatacgatatcggttttcagtctttaagtggagcttttgaacgaggtcacaac
tttatgtatgtctgtctcgataacgaagtgtatgcaaacactggaggacagagaagttct
tctacgccgatcggcgcaagtactacgacaagtccggccggaagtgtaagttatggtgag
aaaatgatgaaaaagagcatggtagaaatcatggcagaccatggtgcaccatatgttgcg
caggtgagtccaagcaaatggaaagatttggtcaagaaagtgcaaaaaggtttcgaggtg
tatggtcctgtttacattaacgcgcaaagtgcttgtacgacagagtggaaacatgctcca
gaagatacgatcgaagtgagtgatcttggcgtagacagctgtgtatggccattgtatgaa
atcatcaatgagcgtgacgagcatggaatcatctacagtactaaactcaacatcacatat
agaccaaaaaacaagataccggtagaggagtatcttgcagcacaaccaagatttcgacac
cttttcaaaccggaaaacagacacattatcgatctatggcaaaaagctgtggatgcgcga
tgggaatatctacaaagaagagaagaggcaggagtataa

DBGET integrated database retrieval system