KEGG   Nitratiruptor sp. SB155-2: NIS_1603Help
Entry
NIS_1603          CDS       T00565                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, alpha subunit (EC:1.2.7.1)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIS_1603
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_1603
   00020 Citrate cycle (TCA cycle)
    NIS_1603
   00620 Pyruvate metabolism
    NIS_1603
   00640 Propanoate metabolism
    NIS_1603
   00650 Butanoate metabolism
    NIS_1603
  Energy metabolism
   00680 Methane metabolism
    NIS_1603
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NIS_1603
Enzymes [BR:nis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NIS_1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1616060..1617277)
Genome map
AA seq 405 aa AA seqDB search
MAKKYELNEVEVWDGNMAAAHALRQAQVDILAAYPITPSTPIVQNYSKFLADGYVDGEFI
MVESEHSAMSGCVAASAAGVRAATATSSQGFALMVEVLYQASGMRLPIVLTVVNRALAAP
LNVNGDHSDMYLGRDAGWINLCSYNPQEAYDLTLMAFKIGEDLNVRLPVMVHQDGFICSH
TAQNVRPLQDEEAQEFVGEYKAVNSMLDVANPVTHGVQTEEDWHFEHKARQHNDLMNSFD
TIKKVFNEFKERTGREYDLVYTYKMDDADVAIFALGTTVESARIAADEMRQQGIKAGVVS
LRVLRPFPFKEVAQALDNVKAVAAMDRSAPGGTFGALFNEISATMLAHGKSPIVLNYIYG
LGGRDTTIDMLKGVYEDLDKCAKAGEVVVPLQQFLGLRGPKLSFY
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaagtatgaattaaatgaagtagaggtttgggatggaaatatggcagccgcc
catgcgctcagacaagcgcaagtcgatatattggctgcatatcctattactccttctaca
ccgattgttcaaaactactccaagtttttggcagatggatatgtagatggtgaatttatc
atggttgagtctgagcactcagcaatgagtggttgtgtcgctgcaagtgctgcaggggta
agagcagctaccgcgacaagttcacaaggttttgcgctcatggtagaggtcctctatcaa
gcaagcgggatgcgacttcctattgtcttgacggttgtcaatcgtgcgcttgcggctcca
ttgaacgttaacggggaccactccgatatgtatcttggtcgggatgccggatggatcaat
ctgtgttcgtacaatccgcaagaagcctatgatttgaccttgatggcttttaaaatcggt
gaagatctcaatgtccgacttcctgtgatggtacatcaagacggttttatctgttctcat
actgctcaaaacgtacgaccccttcaagatgaagaagcacaagagttcgtaggagagtat
aaggcggttaattccatgctcgatgttgcaaatcctgtaacacacggtgtgcaaacggaa
gaggattggcactttgaacacaaagcgagacagcataacgacttgatgaattcatttgat
acgatcaaaaaagttttcaatgaatttaaagagagaaccggcagagaatatgatcttgta
tatacctataaaatggatgatgcggatgtggctatctttgcgcttgggacgacagttgag
agtgcgagaatcgcagctgacgagatgcgtcaacaagggattaaagctggagtcgttagt
ttaagagttcttcgcccattcccatttaaagaggttgcacaagctctggacaatgtcaag
gctgtagcagctatggatagaagtgctcctggtggaacatttggtgcacttttcaacgaa
atcagtgccactatgcttgcacatggaaaatcgccgatagtgctcaactacatctatgga
cttggcggacgagatactacaattgatatgcttaaaggtgtgtatgaagatcttgacaag
tgtgcgaaagctggcgaggtagttgtgccattgcaacagttcttgggacttagaggtccg
aagctatcgttttattaa

DBGET integrated database retrieval system