KEGG   Nitratiruptor sp. SB155-2: NIS_1638Help
Entry
NIS_1638          CDS       T00565                                 

Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nis  Nitratiruptor sp. SB155-2
Brite
Enzymes [BR:nis01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NIS_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1648356..1649270
Genome map
AA seq 304 aa AA seqDB search
MKKLFFFFIPLLLLAFEPIKPIPEHISYNKQKALLGKYLFFDPILSKNRKISCSSCHDFN
HGGADPRPVSVGVGGKKGKVNSPTVYNAYFNFRQFWNGRARDLKDQANGPVHAPNEMAMD
AKEIEKRLNNNPFYKKLFKKVYHTDHIKYWMVLDAIAEFEKALITPDSKFDLYLKGKAKL
SPLEKKGYILFKQLGCITCHNGINIGGNSFQKIGAVKPYDKPAVGDRYEVTKRAFDRYRY
KVPSLRNIALTAPYFHDGSVKTLDEAVEKMAYHNLGFKLSPEEKKAIVAFLKTLTGKKPK
ILEQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattgttctttttttttatacctctgctcctcttggcattcgagcccattaaa
cctattccagaacatatttcttacaacaaacaaaaagcacttttaggaaaatatcttttc
ttcgatcccattctttccaaaaacagaaaaatcagctgttctagctgtcatgacttcaat
catggaggggctgacccaagaccggtctctgtaggggtgggtggcaaaaaaggaaaagtc
aattccccgaccgtttataacgcctacttcaattttaggcaattttggaacggaagagcg
agagatctcaaagatcaggcaaacgggccggtccatgctcccaacgagatggctatggac
gcaaaagagatcgaaaaaaggcttaacaacaaccccttttacaagaaacttttcaaaaag
gtttatcataccgatcatatcaaatactggatggtgctcgatgcgatagccgaatttgaa
aaagccctgatcacgcccgattcaaagtttgatctttatctcaaaggcaaagcaaaactt
tcacccttggaaaagaaagggtatattcttttcaagcagcttggatgtatcacctgccac
aacggcatcaatatcggagggaactcctttcaaaaaatcggtgccgtaaaaccgtatgac
aagccggcagtcggtgacagatacgaagtaacaaaaagagcatttgaccgctacagatac
aaagtccccagccttcgcaatatcgctctcactgctccctattttcatgacggttcggtt
aaaacactggatgaagcggtagagaaaatggcttatcacaacctgggatttaaactctct
cccgaagaaaaaaaagcgatcgtcgcttttttgaaaacattaactggtaaaaaaccgaag
attttagagcaatga

DBGET integrated database retrieval system