KEGG   Nitratiruptor sp. SB155-2: NIS_1789Help
Entry
NIS_1789          CDS       T00565                                 

Definition
nitrous-oxide reductase NosZ (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NIS_1789
Enzymes [BR:nis01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     NIS_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1807185..1809788)
Genome map
AA seq 867 aa AA seqDB search
MYRVMKRLISLVAAAGLVSTVSLAQGELEKIMKERGLTQDDILAAAKTYTPSGGRDKYIV
FSSGGQSGQIMVYGVPSMRILKFIGVFTPEPWQGWGYDDDTKKVLKEGWRNGKKITWGDT
HHPALSETNGVYDGKWLVINDKANPRLAVIDLKDFVTKQIVVNPVFKSDHGGAFFTPNSE
YILEACQYAAPFDNNYHPMEEYVDVYRGGVTVWKFDHENGRIIPDQSFTIEMPPYMQDLS
DAGKELSYGWGFTNSFNSEMYTGGIEKGLPPFEAGCSRNDTDYLHVYNWRKLAELAKDPK
NVKIINGHKVIPIEVAVKNDCLFLIPEPKSPHGVDVSPDGRYIVVCGKLDTHATVYDFKK
IMEAVKNHDFAGKDPYGIPIIDMKKAMHCQAELGLGPLHNQYGPKWKTEGEIYTSLYVDS
QVVKWDYLNCEIKDRVNVNYNIGHLCGMEGKTEDPQGEYIIALNKLAIDRFNPIGPLHPQ
NHQLIDVSGKKMKLLYDMPVPLGEPHQAVAIRASKLHPEVRYPMGTNPFTGKIHRGKTLA
GQEKIVRKGNHVYVYGTLVRSHINPEHVTVNKGDIVTFYLTNLERAEDETHGFTVDWYNV
HASLEPGKTVAVTFKADQEGVFPYYCTEFCSALHLEMMGYLLVKDPNKVYKSVRKIKLKK
MSKEELMKEYKKTVALNEATKKVIQSVVKFLKENHYEKYPVVKQLVEDALDQFNKVPAEE
KKAEEALKKGDIETAINFQYQAWQYLVKAADVGIRAKDLLVKKLATPMSEAAKRGEIAFA
EGGCNGCHVIGKVSSGPDLVGVLQRHENGEKWVAEFIKNPSKFYNDPYVKTLIDYFNLRM
PNQHMSDQQIKDIIEYLKWIDQNAHLF
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgagtcatgaaaaggctgataagccttgtggcggcggcgggactggtttctact
gtttcacttgcgcaaggtgagctagaaaagattatgaaagagcgggggttgacgcaagat
gatatcctcgcggcggcaaaaacctatacaccatcaggtggaagagataaatatatcgta
ttcagctccggcggacaatctgggcagattatggtgtatggtgtaccttccatgcggatt
ttaaagtttatcggtgtttttactcctgagccttggcaaggttggggatatgatgatgac
acgaagaaggtcttgaaagagggttggcgtaacggtaaaaagattacctggggagatacg
caccacccggcactctctgaaacaaacggtgtatacgatggaaagtggcttgttattaac
gataaagcgaatccaagactcgcagtcatcgacttaaaagatttcgtgacaaagcagatt
gttgtcaatccggtttttaagtccgatcatggtggagcattttttacgccaaacagtgaa
tatattttagaagcgtgtcaatatgcagctccttttgacaacaactatcatcctatggaa
gagtatgtagatgtgtaccgtggtggtgtaacggtttggaagttcgatcatgaaaatgga
cgtattattccagatcagtcgttcactatcgagatgccgccttatatgcaggatttgagc
gatgcgggtaaagagttgagctatggatggggctttaccaactcttttaactctgaaatg
tatactggtggaatcgaaaaagggcttcctccatttgaagctggttgtagccgaaacgat
acggactacttgcacgtatataactggagaaaactagcagaacttgccaaagatccaaaa
aatgtgaaaatcatcaatgggcacaaagttattccgatcgaagtagcggtgaaaaacgat
tgtctcttcttgattcctgagccaaaatccccacacggtgtggatgtaagcccggatggt
cgctacatcgttgtgtgcggtaagctcgatacccatgcaacggtatatgatttcaaaaag
atcatggaagcggtgaaaaatcacgattttgcaggaaaagacccatatggtattccgatt
atcgacatgaaaaaagcaatgcattgtcaagctgaacttggtctaggaccactgcataac
cagtatggtccaaaatggaaaaccgaaggagaaatctatacctcactctatgttgacagc
caggttgtcaagtgggattatctcaactgtgaaatcaaagatagagtcaatgtaaattac
aatatcggtcacctttgtggaatggaaggtaaaacggaagatccacaaggcgaatatatt
attgctttgaataaacttgcaatcgatagattcaatccaatcggaccacttcatccacaa
aaccaccagttgatcgatgtaagcggtaaaaaaatgaaactgctttatgacatgccggta
cctttgggtgaaccgcaccaagcagtagcgattcgggcaagcaaacttcacccagaagtt
cgatacccaatggggacgaatccatttacaggaaaaattcatagaggaaaaacgcttgct
ggacaagaaaaaattgttcgcaaaggaaaccatgtctatgtttacggcactcttgttcga
agccacatcaatcctgagcacgtaactgtcaacaaaggcgacatcgttacattctatctc
acaaacctagagagagcagaagacgaaacacacggattcacagtagattggtacaatgtc
catgcatcacttgagcctggtaaaacggtagcggtgacatttaaagcagatcaagaaggg
gtcttcccttactactgtacagagttctgttctgcacttcacctagagatgatgggatac
ttgcttgtaaaagatccgaataaagtctacaaatctgtacgaaaaatcaaactcaaaaaa
atgagcaaagaagagctcatgaaagagtacaaaaaaacagtcgctctcaacgaagcaacc
aaaaaagttatccaaagcgttgtgaaattcttgaaagagaatcactatgaaaaatatcct
gttgtgaaacagcttgtagaagatgcactcgatcagttcaacaaagtgccagctgaagag
aaaaaagccgaagaggcactcaaaaaaggcgatatagaaacggcgatcaacttccaatac
caagcatggcaatatcttgtaaaagctgccgacgttggaatccgtgcgaaagatttgtta
gtgaaaaaacttgcaactccaatgagcgaagctgcaaaacgaggagagatagcctttgct
gaaggaggttgtaacggatgtcacgttatcggtaaagtaagttccggaccagaccttgta
ggggtactccaacgtcacgaaaatggtgaaaaatgggttgcagaatttatcaaaaaccca
tctaagttctacaatgatccgtatgtgaaaacattgattgactacttcaacctccgaatg
ccgaatcagcatatgagcgatcagcaaatcaaagatatcatcgaatatctcaagtggatc
gatcaaaacgctcatctcttctaa

DBGET integrated database retrieval system