KEGG   Nitrosomonas sp. AL212: NAL212_0233Help
Entry
NAL212_0233       CDS       T01443                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NAL212_0233
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NAL212_0233
Enzymes [BR:nit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     NAL212_0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
81758..83284
Genome map
AA seq 508 aa AA seqDB search
MTVKKKGSKGFDFHRLEELGVEIKNLVADSRQIKPGDTFLAYPGDTTDGNKFIPQAIAAG
ANAVLYDPRNFVWKSEWRIPALAVDDLKMKAGLIASYVYDHPSQKLWVVGITGTNGKTSC
SHWYAQAMVNLGYKTAVLGTLGSGYIENLQGTENTTPDATVLQRSFKKFVDEGAKNVVME
VSSHGLAQGRTMGTAFSVALLTNLSRDHLDYHQDMDAYAAAKSSLFFWPGLKYAVVNMDD
VLGVELSRQLVTKPIKMMGYGFRYPENRDSKQFKMVHGSNLKFDIHGMEFDIEFEDSHEH
LRIGLLGKFNASNLLAVVAALLASGIRLPDAVGSLQSVQSIPGRMEKYYGINQSTIIVDY
AHTPDALEKVLCTLRELLRIEGRNARLFCVVGCGGDRDRGKRAMVGEVATRLADEVIFTS
DNPRSEDPLRIIEDIAAGAVEGNYQVEVDRALAIYQAIANARSNDIVLIAGKGHEKFQEI
KGQKISFSDAEVVQQVLKELSVKVRVQQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgacggtaaaaaagaaaggatcgaaaggatttgattttcatcgacttgaagaattgggc
gtggagattaagaatctggtggcggatagtcgtcagataaaaccgggagatacctttctg
gcttacccaggggatacgacggacgggaataaatttattccccaagccattgcagcgggc
gccaatgcggttctctatgatccgcgaaatttcgtatggaaatctgaatggcgtatccct
gcattagcggtagatgatctcaagatgaaagcgggcctgattgccagttatgtttatgat
catccgtcacaaaaattatgggtggtgggaattaccgggactaatggcaagacatcatgc
agtcattggtatgcacaagccatggtgaatttggggtataagacggctgtgctgggaacc
ctggggagcgggtatatagagaatttgcaaggcacagaaaatacaacgccagatgccacg
gtcttgcaacgttcgtttaagaaattcgtcgatgaaggcgctaaaaacgttgtaatggaa
gtgtcttcgcatggcttggcgcaaggccgaaccatgggtacggcattttccgttgctcta
cttaccaacttatcccgggatcatttggattatcaccaggatatggatgcgtatgcggcg
gccaaatcaagcttgtttttttggccgggattaaagtacgccgtggtcaatatggatgac
gtgttaggcgttgaattgtcgcggcaacttgtcactaaacccattaaaatgatgggttac
ggatttcgctaccccgagaaccgtgattccaagcaatttaaaatggtacatggctcaaat
ctgaaatttgatattcatggcatggaatttgatattgaatttgaggatagccatgaacat
ttaagaataggtttgctgggtaaattcaatgcgtctaatctgctggctgtggtcgcggct
ttgttggcaagcggcattcgattgccggatgcggttggttcacttcaaagcgtgcaatcc
attccgggaagaatggaaaaatattacgggattaatcaatcgactattatcgttgattac
gcgcacactccggatgcattggaaaaagtcttgtgcacgttacgtgaacttttgcgtatc
gaaggtcgaaatgcgcgcttgttctgcgttgtagggtgcggcggcgaccgggacagggga
aagcgcgccatggtgggggaagttgcgacacgtttggcggatgaagttatttttaccagt
gataatccacgttcggaagatcctttgcgcattattgaagatattgctgccggagcagtc
gaagggaattatcaggtagaagtggatcgcgcgctggcaatttatcaagccatcgccaat
gcgcgtagcaacgatattgtgttgatcgcgggtaaggggcatgaaaaatttcaggaaata
aagggacaaaaaatttcttttagcgatgccgaagtggtacaacaggtgctgaaggaattg
tctgtgaaagtgagggtgcagcaatga

DBGET integrated database retrieval system