KEGG   Nitrosomonas sp. AL212: NAL212_0447Help
Entry
NAL212_0447       CDS       T01443                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NAL212_0447
Enzymes [BR:nit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NAL212_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(324876..325661)
Genome map
AA seq 261 aa AA seqDB search
MPTRKQLTGINILVTRPLHQSTFLAENIHASGGKPILLPVLEITDVTDITPLLDLINRLD
EFDWAVFVSPNAVIKSMDLITKQRALPPDLKIAAVGKGTADTLRRYGVNRVLIPIEHFDS
EALLKSEELQNMTEKHVVIFRGNGGRALLGDTLAQRGAHIEYAECYLRRKPEIDSAPLLA
AWSQGKIHAVIITSSEGLHNLFDIIGTLGQQLLKTTPIFTAHDRIAQAARELGLKKIVKV
PYAGDEGLLKGLYIYFQSMEK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgcccacccgcaaacaactgactgggattaacatactggttacccgtccactacatcaa
tccacttttcttgcagaaaacattcacgctagcggtggtaagccgattttacttccagta
ctggaaattactgatgtcacggatattaccccgctgcttgatctgattaatcgtttggat
gaatttgattgggcggtatttgtcagccctaatgctgttatcaaaagtatggatttaatt
accaagcaacgcgcgctacctcctgacttaaaaattgctgccgtaggaaaaggcactgcg
gatactttaagacgatatggagtcaaccgggttcttattccaatcgagcattttgatagt
gaggcattgcttaagtcggaagaattacaaaatatgaccgaaaaacatgtagtgattttt
cgtgggaatggggggcgagcgttattgggtgacacactcgcacaacgcggtgcacatatc
gaatatgcagaatgttacctgcgcagaaaaccagagattgatagtgcacccttacttgct
gcctggtcgcaagggaaaatacacgcagtaatcattacaagtagcgagggattgcataat
ttatttgacataataggcacgcttggccaacaattgctgaaaacaaccccgatttttaca
gcgcatgatcgcattgcccaagcagccagagaattaggattgaaaaaaatcgtgaaagta
ccatacgccggtgatgaaggcttactgaaaggtttgtatatatactttcagtcaatggaa
aaatag

DBGET integrated database retrieval system