KEGG   Nitrosomonas sp. AL212: NAL212_0630Help
Entry
NAL212_0630       CDS       T01443                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nit  Nitrosomonas sp. AL212
Brite
Enzymes [BR:nit01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NAL212_0630
Secretion system [BR:nit02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NAL212_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(508525..509247)
Genome map
AA seq 240 aa AA seqDB search
MAIHLKLFILILSLSLFPGILWADEETVKKAVQPHFENQKIDSVKKTPFSDLYEVVVGDE
LFYTDDKANFFFFGHVINTKTRVSMTNERIQEIKAARRVPFDSLPLQHAITAVKGDGKRK
IAVYTDPNCPYCKQLEKELINVTNVTVYNLLYPVLNGSMELSKKIWCSDNQIKAWEDFML
KGTAPAEKDCETPLETLVKSGRENKVSGTPTLIFTDGSVVGGMIPAAAIEEKLENASKSK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccatacacttaaagcttttcattttaatcttatcattaagtcttttccccggaata
ctttgggccgatgaagaaacagttaagaaagccgtccaaccccatttcgagaatcaaaaa
attgacagtgtaaagaaaacacctttttcagacctatatgaagttgttgtaggcgacgaa
ctgttttataccgatgataaagcaaattttttctttttcggccatgtcatcaacaccaaa
actcgggttagcatgaccaacgaacgcatccaggaaatcaaagcggcacgacgcgtgcca
ttcgactccctgcctctgcagcatgctatcacagcggttaaaggcgatggcaaacgcaaa
attgcggtgtatacagaccctaattgcccttattgcaaacaattggaaaaggaattgatc
aacgtcacgaatgttaccgtttataacctgctctacccggtcttgaatggctcgatggaa
ttatcaaaaaaaatctggtgctctgataatcaaatcaaggcctgggaggattttatgctg
aaaggcaccgcaccagcagaaaaagactgcgaaactcccttggaaactttggtaaagtca
ggtcgtgaaaataaagtttcaggcacaccaacgctaatttttactgatggctcagttgtt
ggaggaatgatccccgcagcagccatagaggaaaagttggaaaacgcaagcaaaagcaaa
taa

DBGET integrated database retrieval system