KEGG   Nitrosomonas sp. AL212: NAL212_0758Help
Entry
NAL212_0758       CDS       T01443                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NAL212_0758
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NAL212_0758
Enzymes [BR:nit01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     NAL212_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
643111..644064
Genome map
AA seq 317 aa AA seqDB search
MINRNPQLDENGALQHLLTTEGLPGSMLLHILDTAESFVGVTERDVKKIPLLRGKSIFNL
FFESSTRTRTTFEIAAKRLSADVINLNIAVSAQSKGETLLDTVDNLSAMNADMFVVRHAQ
SGAAHLIAKHVRSDIHVINAGDGSHAHPTQALLDMFTIRRYKHDFRNLRVAIIGDILHSR
VARSQIHALTTLGVPEVRVIAPKTLLPKMVERLGVHVYHDMATGLKDVDVLMMLRLQNER
MKGANLPSAEEYFKYYGLTVDKLSLARRDAIVMHPGPMNRGVEIDSAVADGKQSVILPQV
TFGIAVRMAVMSILTGN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatagaaatccgcagttggatgaaaatggtgcattgcagcatttgttgacaacg
gaaggtttgccggggtctatgctgcttcatattctggatacagccgaatcttttgtgggg
gttactgagcgtgatgtcaagaaaataccattgctgcgtggtaagtcgatattcaatctt
ttctttgaatcaagtacgcgtacaagaaccacgtttgaaattgctgccaaacgtttgtca
gctgatgtcatcaatttaaatattgctgtttctgcacaatccaagggtgagacactgttg
gatactgtggacaatctttctgcaatgaatgccgatatgtttgtggtgcgacatgctcaa
agtggcgctgctcacttgattgcaaaacatgtccgctcagatattcatgtcatcaatgct
ggggatggaagccatgcgcatcctactcaagctctgttagatatgtttacgatacggcgt
tacaagcatgattttcgcaacttacgtgttgccattatcggtgatattttacattcccga
gtagcgcggtcccagattcacgccttaacaacactgggtgttcctgaagtgcgcgttatc
gcaccgaaaactttgctgcccaaaatggtggaacgccttggtgtgcatgtttatcatgat
atggcaaccggcctaaaagatgttgatgtattgatgatgttgcgtttgcagaatgagcga
atgaagggtgcaaatttacctagtgcggaggaatattttaagtattatggactgactgtg
gataagctgtcacttgctcggcgtgatgcaatagtgatgcatcctggaccaatgaatcgt
ggcgtggagatcgattcggcagttgcagatggtaaacaatcggtaattttgcctcaagtg
acatttggcattgcagtgcgtatggctgtgatgtcgatcttaacaggtaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system